JPUB_006826
(Plasmid
#87923)
-
PurposeE. coli expression of K. stuttgartiensis protein
-
Depositing Lab
-
Sequence Information
Ordering
| Item | Catalog # | Description | Quantity | Price (USD) | |
|---|---|---|---|---|---|
| Plasmid | 87923 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $89 | |
Backbone
-
Vector backbonepET28
-
Vector typeBacterial Expression
Growth in Bacteria
-
Bacterial Resistance(s)Kanamycin, 50 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)NEB Stable
-
Copy numberHigh Copy
Gene/Insert
-
Gene/Insert nameKuste3608
-
SpeciesK. stuttgartiensis
- Promoter T7
-
Tag
/ Fusion Protein
- 6xHis (N terminal on backbone)
Cloning Information
- Cloning method Restriction Enzyme
- 5′ cloning site unknown (unknown if destroyed)
- 3′ cloning site unknown (unknown if destroyed)
- 5′ sequencing primer T7
- (Common Sequencing Primers)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
protein sequence: MGSSHHHHHHSSGLVPRGSHMKKMMLINPHKPGRHGEESITVIVQMPLNLAYIKALTPGDWEFDVIDENIELAIDDNGELTFAPVDLVCITSVTYQSPRAYKIATACKRKGMTVIMGGIHASVMPEEASKYVDTVFIGEAEEVWPRVIKDFEAGKLKKVYDGGLPPLNLMKRVFPDREFLRKKYNYKFSSIVTTKGCPNYCDFCSVPTFQGRKFRERPYEDVLEELAATDYKGLMLAEDNFYGHGKRSNERARNLFKGMVERNLQKDWLGFTALNISQDKETLDYMAKSGCFGMLMGIESTNETVLEKMNKQVNLKLGTESYYDCIQKIHDAGLVTWGSVVFGADGDGKDSFKRMTDFILENNIDILTFGINCPFPKTQLYKRLDSEKRIFRKNYPDDWEYYDTAHVVHRLVDMTLEDFIEGMQYVYDHIYAGDNLRKRFRNSIKTTNNPRNSMFAFRVGSDWQQVFDQVLENLRLLYDSGDYYKDYYKSNSVSVSKKPLVESITT-
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
JPUB_006826 was a gift from Harry Beller (Addgene plasmid # 87923 ; http://n2t.net/addgene:87923 ; RRID:Addgene_87923) -
For your References section:
Investigation of Proposed Ladderane Biosynthetic Genes from Anammox Bacteria by Heterologous Expression in E. coli. Javidpour P, Deutsch S, Mutalik VK, Hillson NJ, Petzold CJ, Keasling JD, Beller HR. PLoS One. 2016 Mar 14;11(3):e0151087. doi: 10.1371/journal.pone.0151087. eCollection 2016. PONE-D-16-02052 [pii] PubMed 26975050