We narrowed to 16,589 results for: LEA
-
Plasmid#169126Purposeexpression of proteinDepositorAvailable SinceMay 7, 2021AvailabilityAcademic Institutions and Nonprofits only
-
GST PTBP1 isoform 4
Plasmid#108594PurposeRecombinant GST tagged protein productionDepositorInsertPTBP1 isoform 4 (PTBP1 Human)
TagsGSTExpressionBacterialMutationisoform 4 (isoform a)PromotertacAvailable SinceDec. 12, 2018AvailabilityAcademic Institutions and Nonprofits only -
pFLAG-Tetherin
Plasmid#41070DepositorAvailable SinceOct. 30, 2012AvailabilityAcademic Institutions and Nonprofits only -
AAVi U6_gRNA CMV_SadCas9-KRAB
Plasmid#214609PurposeAll-in-one AAVi plasmid expressing S. aureus dCas9-KRAB with sgRNA cassetteDepositorInsertsgRNA
SadCas9
UseAAVTagsNP NLS and SV40 NLSExpressionMammalianMutationD10A, N580APromoterCMV and U6Available SinceMarch 12, 2024AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP6-Myc-FLAG (puromycin)
Plasmid#86851Purposemammalian expression of ATP6 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP6 (ATP6 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon correctedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pLVX-EF1a-Calr-KDEL-IRES-Puromycin
Plasmid#134664PurposeExpresses EGFP-tagged endoplasmic reticulum markerDepositorInsertcalreticulin (CALR Human)
UseLentiviralTagsEGFPExpressionMammalianMutationdeleted amino acids 18-413PromoterEF1aAvailable SinceMarch 2, 2020AvailabilityAcademic Institutions and Nonprofits only -
pAAV-TPH2-Cre
Plasmid#189616PurposeExpresses Cre recombinase under the control of the tryptophan hydroxylase promoterDepositorInsertCre Recombinase
UseAAVExpressionMammalianPromoterTph2Available SinceMarch 15, 2023AvailabilityAcademic Institutions and Nonprofits only -
pET30a-HS-Tn5
Plasmid#127916PurposeProkaryotic expression of Hyperstable Tn5 (HS-Tn5) for Illumina library preperation. Developed for the large scale ChIP-Seq and ATAC-Seq experiments for the fruitENCODE and Maize Cistrome projects.DepositorInsertHyperstable Tn5
TagsE coli elongation factor Ts and Mxe intein - Chit…ExpressionBacterialMutationE54K, L372PPromoterT7Available SinceJuly 5, 2019AvailabilityAcademic Institutions and Nonprofits only -
pGL3-NBRE3
Plasmid#208254PurposepGL3 promoter luciferase reporter vector containing 3 copies of the NBRE DNA response element (5′-GAGTTTTAAAAGGTCATGCTCAATT TGTC-3′) used for luciferase reporter assays in mammalian cellsDepositorInsert3X NBRE-LUC
ExpressionMammalianPromoterSV40 early promoterAvailable SinceFeb. 28, 2024AvailabilityAcademic Institutions and Nonprofits only -
pCdOpt-BMX
Plasmid#203929PurposeThis plasmid contains a codon optimized BleMX drug resistance cassette for generating gene deletions in C. glabrata, C. auris, C. albicans or S. cerevisiaeDepositorInsertBleMX
ExpressionYeastMutationBleMX was codon optimized for Candida albicans or…Available SinceDec. 18, 2023AvailabilityAcademic Institutions and Nonprofits only -
pANAP-P2A-eRF(E55D)
Plasmid#241290PurposeAllows co-translational incorporation of the fluorescent ncAA Anap directly into the target protein; expresses tRNACUA-Leu, AnapRS, and dominant negative ribosomal release factorDepositorInsertthe amber suppressor tRNACUA-Leu
ExpressionMammalianMutationmutant E.coli leucyl synthetase specific for Anap…PromoterCMVAvailable SinceDec. 11, 2025AvailabilityAcademic Institutions and Nonprofits only -
eSpCas9(1.1)
Plasmid#138555PurposeExpresses human codon-optimized enhanced specificity SpCas9 and blasticidin resistance: EFS promoter-eSpCas9(1.1)-NLS-FLAG-P2A-BSDDepositorInserteSpCas9(1.1)
UseCRISPR and LentiviralTagsBSD, FLAG, and NLSExpressionMammalianMutationK848A, K1003A, R1060APromoterEFSAvailable SinceJune 9, 2020AvailabilityAcademic Institutions and Nonprofits only -
pLV-EF1a-Itprip-V5
Plasmid#120241PurposeExpresses V5-tagged Itprip in lentiviral vectorDepositorAvailable SinceJan. 9, 2019AvailabilityAcademic Institutions and Nonprofits only -
pLVH-EF1a-GFP-P2A-SOX2
Plasmid#130693PurposeLentiviral plasmids encoding human SOX2 with co-expressoin of GFP mediated by P2A.DepositorInserthuman SOX2 (SOX2 Human)
UseLentiviralAvailable SinceAug. 22, 2019AvailabilityAcademic Institutions and Nonprofits only -
SpCas9-HF1
Plasmid#138556PurposeExpresses human codon-optimized high-fidelity SpCas9 and blasticidin resistance: EFS promoter-SpCas9-HF1-NLS-FLAG-P2A-BSDDepositorInsertSpCas9-HF1
UseCRISPR and LentiviralTagsBSD, FLAG, and NLSExpressionMammalianMutationN497A, R661A, Q695A, Q926APromoterEFSAvailable SinceJune 9, 2020AvailabilityAcademic Institutions and Nonprofits only -
Cas9-NAT
Plasmid#64329PurposeCas9 expression cassette carried by a yeast single-copy episome plasmidDepositorInsertHuman-optimized S. pyogenes Cas9 with Clonnat marker gene expression cassette
UseCRISPRExpressionYeastAvailable SinceApril 29, 2015AvailabilityAcademic Institutions and Nonprofits only -
pCEP4-BG505.SOSIP-8his
Plasmid#111847PurposeMammalian expression plasmid for soluble BG505 SOSIP.664DepositorInsertHIV-1 Env (BG505 SOSIP.664)
Tags8his purification tag and CD5 leader sequenceExpressionMammalianMutationCodon-optimized synthetic gene; has SOSIP mutatio…PromoterCMVAvailable SinceMarch 25, 2019AvailabilityAcademic Institutions and Nonprofits only -
pCAG_iPE-N
Plasmid#214734Purposeencodes iPE-N prime editor (with MMLV-RT(H8Y, D200N, T306K, W313F, T330P, L603W) fused to the N terminus of nCas9-H840A) driven by a CAG promoterDepositorInsertCAG_iPE-N_bGH
UseCRISPR and Synthetic BiologyExpressionMammalianAvailable SinceMarch 12, 2024AvailabilityAcademic Institutions and Nonprofits only -
pAAV-EF1a-DIO-GRAB_g5-HT3.0
Plasmid#208726PurposeExpresses the green 5-HT sensor GRAB_g5-HT3.0 in neurons in the presence of Cre recombinaseDepositorInsertGreen fluorescent 5-HT sensor GRAB_g5-HT3.0
UseAAVPromoterEF1aAvailable SinceOct. 30, 2023AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3 P-cad
Plasmid#47502PurposeExpresses P-cadherin in mammalian cellsDepositorAvailable SinceSept. 26, 2013AvailabilityAcademic Institutions and Nonprofits only