pHH0103 NEDD4L WW domain #3
(Plasmid
#104206)
-
PurposeBacterial expression of WW domain #3 from NEDD4L
-
Depositing Labs
-
Publication
-
Sequence Information
Ordering
| Item | Catalog # | Description | Quantity | Price (USD) | |
|---|---|---|---|---|---|
| Plasmid | 104206 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $89 | |
Backbone
-
Vector backbonepHH0103
-
Vector typeBacterial Expression
Growth in Bacteria
-
Bacterial Resistance(s)Ampicillin, 100 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Copy numberUnknown
Gene/Insert
-
Gene/Insert nameNEDD4L WW domain #3
-
SpeciesH. sapiens (human)
-
Insert Size (bp)108
-
Mutationcodon optimized for expression in bacteria
-
Entrez GeneNEDD4L (a.k.a. NEDD4-2, NEDD4.2, PVNH7, RSP5, hNEDD4-2)
- Promoter tac
-
Tag
/ Fusion Protein
- GST (N terminal on backbone)
Cloning Information
- Cloning method Restriction Enzyme
- 5′ cloning site SfiI (unknown if destroyed)
- 3′ cloning site NotI (unknown if destroyed)
- 5′ sequencing primer pGEX-5' (Common Sequencing Primers)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - TQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFP
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
pHH0103 NEDD4L WW domain #3 was a gift from Sachdev Sidhu & Marius Sudol (Addgene plasmid # 104206 ; http://n2t.net/addgene:104206 ; RRID:Addgene_104206)