mCherry-SH3(5R)
(Plasmid #112154)

• Purpose: Mammalian expression plasmid for SH3-5R in a vector expressing mCherry.
• Depositing Lab: Michael Rosen
• Depositing Organization: University of Texas Southwestern Medical Center
  Located in the United States of America
• Publication: Li et al Nature. 2012 Mar 7;483(7389):336-40. doi: 10.1038/nature10879.

Backbone

• Vector backbone: pmCherry-N1
• Backbone manufacturer: Clontech
• Backbone size w/o insert (bp): 4700
• Total vector size (bp): 5906
• Modifications to backbone: unknown if there are any modifications to backbone. size is an estimate
• Vector type: Mammalian Expression
• Selectable markers: Neomycin (select with G418)

Growth in Bacteria

• Bacterial Resistance(s): Kanamycin, 50 μg/mL
• Growth Temperature: 37°C
• Growth Strain(s): DH5alpha
• Copy number: Unknown

Gene/Insert

• Gene/Insert name: SH3-5R
• Alt name: 5 repeats of second SH3 domain of Nck1 (Nck adaptor protein 1)
• Species: H. sapiens (human)
• Insert Size (bp): 1208
• Mutation: only the second SH3 domain is expressed in this construct
• GenBank ID: NM_001190796.2
• Entrez Gene: NCK1 (a.k.a. NCK, NCKalpha, nck-1)
• Promoter: CMV

Cloning Information

• Cloning method: Restriction Enzyme
• 5′ cloning site: EcoRI (not destroyed)
• 3′ cloning site: BamHI (not destroyed)
• 5′ sequencing primer: EGFP-N Sequencing Primer (CMV forward primer): 5'-CGCAAATGGGCGGTAGGCGTG-3'
• 3′ sequencing primer: mCherry-R: 5'-TTGGTCACCTTCAGCTTGG-3'

Terms and Licenses

• Academic/Nonprofit Terms:
  • UBMTA
• Industry Terms:
  • Not Available to Industry

Depositor Comments

protein sequence:
HMDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKSSDGWWRGSYNGQVGWFPSNYVTEEGDSPLASGAGGSEGGGSEGGTSGATDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKSSDGWWRGSYNGQVGWFPSNYVTEEGDSPLASGAGGSEGGGSEGGTSGATHMDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKSSDGWWRGSYNGQVGWFPSNYVTEEGDSPLASGAGGSEGGGSEGGTSGATDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKSSDGWWRGSYNGQVGWFPSNYVTEEGDSPLASGAGGSEGGGSEGGTSGATDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKSSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGRDPPVAT (-mCherry)

DNA (Catalog # 112154-D50)

Purpose

Ready-to-use, high-purity DNA prep. DNA aliquots are suitable for use in mammalian cell transfections and other molecular biology applications.

Delivery

• Amount: 50 μg
• Concentration: 1 μg/μL
• Pricing: $495 USD
• Storage: 4 ℃ (short-term) or -20 ℃ (long-term)

Terms and Licenses

• Academic/Nonprofit Terms:
  • UBMTA
• Industry Terms:
  • Not Available to Industry

Quality Control

Every DNA prep is verified by next-generation sequencing, confirming plasmid identity, sequence integrity, and absence of DNA contaminants. Concentration is confirmed to be within ±2.5% of the stated concentration.

Our production process has been validated to consistently yield endotoxin levels below 1.0 EU/μg. Individual lots are not tested for endotoxin.

DNA (Catalog # 112154-D100)

Purpose

Ready-to-use, high-purity DNA prep. DNA aliquots are suitable for use in mammalian cell transfections and other molecular biology applications.

Delivery

• Amount: 100 μg
• Concentration: 1 μg/μL
• Pricing: $585 USD
• Storage: 4 ℃ (short-term) or -20 ℃ (long-term)

Terms and Licenses

• Academic/Nonprofit Terms:
  • UBMTA
• Industry Terms:
  • Not Available to Industry

Quality Control

Every DNA prep is verified by next-generation sequencing, confirming plasmid identity, sequence integrity, and absence of DNA contaminants. Concentration is confirmed to be within ±2.5% of the stated concentration.

Our production process has been validated to consistently yield endotoxin levels below 1.0 EU/μg. Individual lots are not tested for endotoxin.