Skip to main content
This website uses cookies to ensure you get the best experience. By continuing to use this site, you agree to the use of cookies.

Please note: Your browser does not support the features used on Addgene's website. You may not be able to create an account or request plasmids through this website until you upgrade your browser. Learn more

Please note: Your browser does not fully support some of the features used on Addgene's website. If you run into any problems registering, depositing, or ordering please contact us at [email protected]. Learn more

mCherry-SH3(5R)
(Plasmid #112154)

Ordering

Item Catalog # Description Quantity Price (USD)
Plasmid 112154 Standard format: Plasmid sent in bacteria as agar stab 1 $85

This material is available to academics and nonprofits only.

Backbone

  • Vector backbone
    pmCherry-N1
  • Backbone manufacturer
    Clontech
  • Backbone size w/o insert (bp) 4700
  • Total vector size (bp) 5906
  • Modifications to backbone
    unknown if there are any modifications to backbone. size is an estimate
  • Vector type
    Mammalian Expression
  • Selectable markers
    Neomycin (select with G418)

Growth in Bacteria

  • Bacterial Resistance(s)
    Kanamycin, 50 μg/mL
  • Growth Temperature
    37°C
  • Growth Strain(s)
    DH5alpha
  • Copy number
    Unknown

Gene/Insert

  • Gene/Insert name
    SH3-5R
  • Alt name
    5 repeats of second SH3 domain of Nck1 (Nck adaptor protein 1)
  • Species
    H. sapiens (human)
  • Insert Size (bp)
    1208
  • Mutation
    only the second SH3 domain is expressed in this construct
  • GenBank ID
    NM_001190796.2
  • Entrez Gene
    NCK1 (a.k.a. NCK, NCKalpha, nck-1)
  • Promoter CMV

Cloning Information

  • Cloning method Restriction Enzyme
  • 5′ cloning site EcoRI (not destroyed)
  • 3′ cloning site BamHI (not destroyed)
  • 5′ sequencing primer EGFP-N Sequencing Primer (CMV forward primer): 5'-CGCAAATGGGCGGTAGGCGTG-3'
  • 3′ sequencing primer mCherry-R: 5'-TTGGTCACCTTCAGCTTGG-3'
  • (Common Sequencing Primers)

Terms and Licenses

Trademarks:
  • Zeocin® is an InvivoGen trademark.

Depositor Comments

protein sequence:
HMDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKSSDGWWRGSYNGQVGWFPSNYVTEEGDSPLASGAGGSEGGGSEGGTSGATDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKSSDGWWRGSYNGQVGWFPSNYVTEEGDSPLASGAGGSEGGGSEGGTSGATHMDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKSSDGWWRGSYNGQVGWFPSNYVTEEGDSPLASGAGGSEGGGSEGGTSGATDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKSSDGWWRGSYNGQVGWFPSNYVTEEGDSPLASGAGGSEGGGSEGGTSGATDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKSSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGRDPPVAT (-mCherry)

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    mCherry-SH3(5R) was a gift from Michael Rosen (Addgene plasmid # 112154 ; http://n2t.net/addgene:112154 ; RRID:Addgene_112154)
  • For your References section:

    Phase transitions in the assembly of multivalent signalling proteins. Li P, Banjade S, Cheng HC, Kim S, Chen B, Guo L, Llaguno M, Hollingsworth JV, King DS, Banani SF, Russo PS, Jiang QX, Nixon BT, Rosen MK. Nature. 2012 Mar 7;483(7389):336-40. doi: 10.1038/nature10879. 10.1038/nature10879 PubMed 22398450