GLuc-FLAG-CB1
(Plasmid
#158066)
-
PurposeMembrane expression detection of Cannabinoid receptor 1
-
Depositing Lab
-
Sequence Information
Ordering
Item | Catalog # | Description | Quantity | Price (USD) | |
---|---|---|---|---|---|
Plasmid | 158066 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $89 |
Backbone
-
Vector backbonePX459v2
-
Backbone manufacturerFeng Zhang's Lab
- Backbone size w/o insert (bp) 9175
- Total vector size (bp) 10146
-
Modifications to backbonePromoter: chicken β-actin promoter with CMV enhancer
-
Vector typeMammalian Expression, AAV
Growth in Bacteria
-
Bacterial Resistance(s)Ampicillin, 100 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)NEB Stable
-
Copy numberHigh Copy
Gene/Insert
-
Gene/Insert nameCB1
-
Alt nameCNR1 cannabinoid receptor 1
-
SpeciesH. sapiens (human)
-
Insert Size (bp)5996
-
Mutationcontains 4Kb of 3' UTR
-
GenBank ID1268
-
Entrez GeneCNR1 (a.k.a. CANN6, CB-R, CB1, CB1A, CB1K5, CB1R, CNR)
- Promoter pCAG
-
Tag
/ Fusion Protein
- Gaussia Luciferase (N terminal on insert)
Cloning Information
- Cloning method Gibson Cloning
- 5′ sequencing primer ggctgtaattagctgagcaagagg
- 3′ sequencing primer GCTGTCCTGCCCCACCCCAC (Common Sequencing Primers)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
Note that the Addgene verified sequence contains a few ambiguous nucleotides in the CAG promoter region. These discrepancies do not impact plasmid function and are likely due to difficulties sequencing GC-rich regions. The N-terminus of GLuc-Flag-CB1 contains additional residues (MIKIATRKYLGKQNVYDIGVERDHNFALKNGFIASNCFN) which match DnaE-C (NCBI reference WP_114085349.1).
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
GLuc-FLAG-CB1 was a gift from Adolfo Rivero-Muller (Addgene plasmid # 158066 ; http://n2t.net/addgene:158066 ; RRID:Addgene_158066) -
For your References section:
A novel bioassay for quantification of surface Cannabinoid receptor 1 expression. Rodriguez-Rodriguez I, Kalafut J, Czerwonka A, Rivero-Muller A. Sci Rep. 2020 Oct 23;10(1):18191. doi: 10.1038/s41598-020-75331-y. 10.1038/s41598-020-75331-y PubMed 33097803