Skip to main content
Addgene

Venus-30aa-Noxa-pEGFP-C1
(Plasmid #166762)

Ordering

This material is available to academics and nonprofits only.
Item Catalog # Description Quantity Price (USD)
Plasmid 166762 Standard format: Plasmid sent in bacteria as agar stab 1 $89

Backbone

  • Vector backbone
    pEGFP-C1
  • Vector type
    Mammalian Expression
  • Selectable markers
    Neomycin (select with G418)

Growth in Bacteria

  • Bacterial Resistance(s)
    Kanamycin, 50 μg/mL
  • Growth Temperature
    37°C
  • Growth Strain(s)
    DH5alpha
  • Copy number
    High Copy

Gene/Insert

  • Gene/Insert name
    Noxa
  • Alt name
    PMA-induced protein 1, Venus-Noxa, V-Noxa, VNoxa
  • Species
    H. sapiens (human)
  • Entrez Gene
    PMAIP1 (a.k.a. APR, NOXA)
  • Promoter CMV
  • Tag / Fusion Protein
    • Venus (N terminal on backbone)

Cloning Information

  • Cloning method Restriction Enzyme
  • 5′ cloning site Unknown (unknown if destroyed)
  • 3′ cloning site Unknown (unknown if destroyed)
  • 5′ sequencing primer TGACGCAAATGGGCGGTAGG
  • 3′ sequencing primer TCGCCCTTTGACGTTGGAGTCCAC
  • (Common Sequencing Primers)

Resource Information

  • Supplemental Documents
  • A portion of this plasmid was derived from a plasmid made by
    Noxa sequence aligns with phorbol-12-myristate-13-acetate-induced protein 1 isoform 6 [Homo sapiens] (NCBI Reference Sequence: NM_021127.3)

Terms and Licenses

  • Academic/Nonprofit Terms
  • Industry Terms
    • Not Available to Industry
Trademarks:
  • Zeocin® is an InvivoGen trademark.

Depositor Comments

Venus fused to the N-terminus of human Noxa amino acid sequence: "MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT". Linked by a 30 amino acid (aa) linker.

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    Venus-30aa-Noxa-pEGFP-C1 was a gift from David Andrews (Addgene plasmid # 166762 ; http://n2t.net/addgene:166762 ; RRID:Addgene_166762)