Skip to main content

Venus-30aa-Noxa-4E-pEGFP-C1
(Plasmid #167529)

Ordering

This material is available to academics and nonprofits only.
Item Catalog # Description Quantity Price (USD)
Plasmid 167529 Standard format: Plasmid sent in bacteria as agar stab 1 $89

Backbone

  • Vector backbone
    pEGFP-C1
  • Vector type
    Mammalian Expression
  • Selectable markers
    Neomycin (select with G418)

Growth in Bacteria

  • Bacterial Resistance(s)
    Kanamycin, 50 μg/mL
  • Growth Temperature
    37°C
  • Growth Strain(s)
    DH5alpha
  • Copy number
    High Copy

Gene/Insert

  • Gene/Insert name
    PMA-induced protein 1
  • Alt name
    Noxa
  • Species
    H. sapiens (human)
  • Mutation
    C25E, L29E, F32E, L36E
  • Entrez Gene
    PMAIP1 (a.k.a. APR, NOXA)
  • Promoter CMV
  • Tag / Fusion Protein
    • Venus (N terminal on insert)

Cloning Information

  • Cloning method Restriction Enzyme
  • 5′ cloning site Unknown (unknown if destroyed)
  • 3′ cloning site Unknown (unknown if destroyed)
  • 5′ sequencing primer TGACGCAAATGGGCGGTAGG
  • 3′ sequencing primer TCGCCCTTTGACGTTGGAGTCCAC
  • (Common Sequencing Primers)

Terms and Licenses

  • Academic/Nonprofit Terms
  • Industry Terms
    • Not Available to Industry

Trademarks:

  • Zeocin® is an InvivoGen trademark.

Depositor Comments

The Noxa sequence aligns with phorbol-12-myristate-13-acetate-induced protien 1 isoform 6 [Homo sapiens] (NCBI Reference Sequence: NM_021127.3)

Venus fused to the N-terminus of human Noxa amino acid sequence: "MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT". Linked by a 30 amino acid (aa) linker. Noxa BH3 region has hydrophobic positions H1-H4 mutated to glutamic acid (E), referred to as "BH3-4E" mutation, BH3 mutations: C25E, L29E, F32E, L36E. When compared with EYFP, the Venus fluorophore contains the following mutations: F46L, F64L, M153T, V163A and S175G. This Venus protein contains an A207K, F224R and L232H mutations to make it monomeric. An additional A164V mutation in Venus occurred in this construct, which does not appear to affect fluorescence of the protein.

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    Venus-30aa-Noxa-4E-pEGFP-C1 was a gift from David Andrews (Addgene plasmid # 167529 ; http://n2t.net/addgene:167529 ; RRID:Addgene_167529)