Skip to main content
Addgene

mCherry-7aa-cb5-pEGFP-C1
(Plasmid #177407)

Ordering

This material is available to academics and nonprofits only.
Item Catalog # Description Quantity Price (USD)
Plasmid 177407 Standard format: Plasmid sent in bacteria as agar stab 1 $85

Backbone

  • Vector backbone
    pEGFP-C1
  • Vector type
    Mammalian Expression
  • Selectable markers
    Neomycin (select with G418)

Growth in Bacteria

  • Bacterial Resistance(s)
    Kanamycin, 50 μg/mL
  • Growth Temperature
    37°C
  • Growth Strain(s)
    DH5alpha
  • Copy number
    Unknown

Gene/Insert

  • Gene/Insert name
    Cb5 tail anchor
  • Alt name
    mCherry-Cb5, Ch-Cb5, ChCb5
  • Species
    R. norvegicus (rat)
  • Entrez Gene
    Cyb5r4 (a.k.a. Ncb5or, b5&b5R, b5+b5R, cb5/cb5R)
  • Promoter CMV
  • Tag / Fusion Protein
    • mCherry (N terminal on insert)

Cloning Information

  • Cloning method Restriction Enzyme
  • 5′ sequencing primer TGACGCAAATGGGCGGTAGG
  • 3′ sequencing primer TCGCCCTTTGACGTTGGAGTCCAC
  • (Common Sequencing Primers)

Resource Information

  • Supplemental Documents
  • A portion of this plasmid was derived from a plasmid made by
    See gene entry for "cytochrome b5 [Rattus norvegicus]", See NCBI Reference Sequence: NP_071581.1. Here we have used only the C-terminal tail anchor sequence. mCherry sequence matches GenBank: AZP55984.1.

Terms and Licenses

  • Academic/Nonprofit Terms
  • Industry Terms
    • Not Available to Industry
Trademarks:
  • Zeocin® is an InvivoGen trademark.

Depositor Comments

Transfection of this plasmid will express mCherry-fused to the N-terminus of Cb5 tail anchor sequence" "ITTVESNSSWWTNWVIPAISALVVALMYRLYMAED", which targets the cytoplasmic face of endoplasmic reticulum. There is a flexible, 7 aa linker "SGLRSGK", between mCherry and Cb5.

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    mCherry-7aa-cb5-pEGFP-C1 was a gift from David Andrews (Addgene plasmid # 177407 ; http://n2t.net/addgene:177407 ; RRID:Addgene_177407)