Skip to main content
Addgene

GFP-Bcl2-Cb5
(Plasmid #18000)

Full plasmid sequence is not available for this item.

Ordering

This material is available to academics and nonprofits only.
Item Catalog # Description Quantity Price (USD)
Plasmid 18000 Standard format: Plasmid sent in bacteria as agar stab 1 $89

Backbone

  • Vector backbone
    pEMD-C1
  • Vector type
    Mammalian Expression
  • Selectable markers
    Neomycin (select with G418)

Growth in Bacteria

  • Bacterial Resistance(s)
    Kanamycin, 50 μg/mL
  • Growth Temperature
    37°C
  • Growth Strain(s)
    DH5alpha
  • Copy number
    Unknown

Gene/Insert

  • Gene/Insert name
    ER targeted Bcl-2
  • Alt name
    Bcl-2 Cb5
  • Alt name
    Bcl2 Cytochrome b5
  • Species
    H. sapiens (human)
  • Insert Size (bp)
    761
  • Mutation
    Bcl-2's C terminal targeting sequence replaced with Cytochrome b5. Targets Bcl-2 to the Endoplasmic Reticulum.
  • Entrez Gene
    BCL2 (a.k.a. Bcl-2, PPP1R50)
  • Promoter CMV
  • Tag / Fusion Protein
    • GFP (N terminal on backbone)

Cloning Information

  • Cloning method Restriction Enzyme
  • 5′ cloning site Bgl II (not destroyed)
  • 3′ cloning site Eco RI (destroyed during cloning)
  • 5′ sequencing primer CATGGTCCTGCTGGAGTTCGT
  • (Common Sequencing Primers)

Resource Information

  • A portion of this plasmid was derived from a plasmid made by
    PCR amplified human Bcl-2 from pB4 plasmid purchased from ATCC. PCR amplified Cb5 from EST purchased from ATCC.
  • Articles Citing this Plasmid

Terms and Licenses

  • Academic/Nonprofit Terms
  • Industry Terms
    • Not Available to Industry
Trademarks:
  • Zeocin® is an InvivoGen trademark.

Depositor Comments

Bcl2 amino acids 1-209 plus Cb5 amino acids 100–134 (ITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED).

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    GFP-Bcl2-Cb5 was a gift from Clark Distelhorst (Addgene plasmid # 18000 ; http://n2t.net/addgene:18000 ; RRID:Addgene_18000)
  • For your References section:

    Transient expression of wild-type or mitochondrially targeted Bcl-2 induces apoptosis, whereas transient expression of endoplasmic reticulum-targeted Bcl-2 is protective against Bax-induced cell death. Wang NS, Unkila MT, Reineks EZ, Distelhorst CW. J Biol Chem. 2001 Nov 23. 276(47):44117-28. 10.1074/jbc.M101958200 PubMed 11546793