Skip to main content
This website uses cookies to ensure you get the best experience. By continuing to use this site, you agree to the use of cookies.

Please note: Your browser does not support the features used on Addgene's website. You may not be able to create an account or request plasmids through this website until you upgrade your browser. Learn more

Please note: Your browser does not fully support some of the features used on Addgene's website. If you run into any problems registering, depositing, or ordering please contact us at [email protected] Learn more

GFP-Bcl2-Cb5
(Plasmid #18000)

Full plasmid sequence is not available for this item.

Ordering

Item Catalog # Description Quantity Price (USD)
Plasmid 18000 Standard format: Plasmid sent in bacteria as agar stab 1 $65

This material is available to academics and nonprofits only.

Backbone

  • Vector backbone
    pEMD-C1
  • Vector type
    Mammalian Expression
  • Selectable markers
    Neomycin (select with G418)

Growth in Bacteria

  • Bacterial Resistance(s)
    Kanamycin
  • Growth Temperature
    37°C
  • Growth Strain(s)
    DH5alpha
  • Copy number
    Unknown

Gene/Insert

  • Gene/Insert name
    ER targeted Bcl-2
  • Alt name
    Bcl-2 Cb5
  • Alt name
    Bcl2 Cytochrome b5
  • Species
    H. sapiens (human)
  • Insert Size (bp)
    761
  • Mutation
    Bcl-2's C terminal targeting sequence replaced with Cytochrome b5. Targets Bcl-2 to the Endoplasmic Reticulum.
  • Entrez Gene
    BCL2 (a.k.a. Bcl-2, PPP1R50)
  • Promoter CMV
  • Tag / Fusion Protein
    • GFP (N terminal on backbone)

Cloning Information

  • Cloning method Restriction Enzyme
  • 5′ cloning site Bgl II (not destroyed)
  • 3′ cloning site Eco RI (destroyed during cloning)
  • 5′ sequencing primer CATGGTCCTGCTGGAGTTCGT
  • (Common Sequencing Primers)

Resource Information

Depositor Comments

Bcl2 amino acids 1-209 plus Cb5 amino acids 100–134 (ITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED).

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    GFP-Bcl2-Cb5 was a gift from Clark Distelhorst (Addgene plasmid # 18000 ; http://n2t.net/addgene:18000 ; RRID:Addgene_18000)
  • For your References section:

    Transient expression of wild-type or mitochondrially targeted Bcl-2 induces apoptosis, whereas transient expression of endoplasmic reticulum-targeted Bcl-2 is protective against Bax-induced cell death. Wang NS, Unkila MT, Reineks EZ, Distelhorst CW. J Biol Chem. 2001 Nov 23. 276(47):44117-28. 10.1074/jbc.M101958200 PubMed 11546793