Skip to main content

Anti-Kv7.1/KCNQ1 K+ channel [N37A/10R]
(Antibody #188458)

Ordering

Item Catalog # Description Quantity Price (USD)
Recombinant Antibody 188458-rAb 100 µg of purified recombinant antibody $250 *
Recombinant Antibody trial size 188458-rAb.T 20 µg of purified recombinant antibody $85 *

* Log in to view industry pricing.

Features

Production & Usage

  • Production Plasmid
    Anti-Kv7.1/KCNQ1 K+ channel [N37A/10R]
  • Purification
    Purified from cell culture supernatant using Protein A or Protein G affinity columns followed by a buffer exchange with centrifugal columns.
  • Storage Buffer
    PBS + 1 mM sodium azide

Delivery

  • Concentration
    0.9–1.1 mg/mL
  • Storage
    Upon receipt, prepare single use aliquots and store at -20 °C until use. Avoid multiple freeze thaw cycles.
  • Shipment
    Blue ice or room temp

Resource Information

  • Persistent Resource Identifier
    RRID:AB_2750788

Terms and Licenses

Target Antigen

Protein Potassium voltage-gated channel subfamily KQT member 1
Antigen Description Amino acids 2–101 of human KCNQ1
Antigen Amino Acid Sequence
AAASSPPRAERKRWGWGRLPGARRGSAGLAKKCPFSLELAEGGPAGGALYAPIAPGAPGPAPPASPAAPAAPPVASDLGPRPPVSLDPRVSIYSTRRPVL
Species H. sapiens (human)
Additional Species Reactivity M. musculus (mouse),  R. norvegicus (rat)
Gene KCNQ1
Alternative Names
  • IKs producing slow voltage-gated potassium channel subunit alpha KvLQT1
  • KQT-like 1
  • Voltage-gated potassium channel subunit Kv7.1
External References

Applications (2)

Clear filters

Western Blot

1 image
Western Blot image by UC Davis/NIH NeuroMab Facility
Submitted By: UC Davis/NIH NeuroMab Facility
Antibody Type
Hybridoma
Target Species
Other
Result
Pass
1 image
Western Blot image by UC Davis/NIH NeuroMab Facility
Submitted By: UC Davis/NIH NeuroMab Facility
Antibody Type
Hybridoma
Target Species
R. norvegicus (rat)
Result
Fail
How to cite this antibody ( Back to top)

These antibodies were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the antibodies were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    Anti-Kv7.1/KCNQ1 K+ channel [N37A/10R] - from James Trimmer (Addgene antibody # 188458 ; http://n2t.net/addgene:188458 ; RRID:AB_2750788)
  • For your References section:

    A toolbox of IgG subclass-switched recombinant monoclonal antibodies for enhanced multiplex immunolabeling of brain. Andrews NP, Boeckman JX, Manning CF, Nguyen JT, Bechtold H, Dumitras C, Gong B, Nguyen K, van der List D, Murray KD, Engebrecht J, Trimmer JS. eLife. 2019 Jan 22;8. pii: 43322. doi: 10.7554/eLife.43322. 10.7554/eLife.43322 PubMed 30667360