Skip to main content

Anti-Neurexin-1-alpha [IPI-mNRXN1a.40]
(Antibody #237802)

Ordering

Item Catalog # Description Quantity Price (USD)
Recombinant Antibody 237802-rAb 100 µg of purified recombinant antibody $250 *

* Log in to view industry pricing.

Features

  • Source Species
    O. cuniculus (rabbit)
  • Isotype
    IgG
  • Light Chain Type
    kappa

Production & Usage

  • Recommended Secondary Antibody
    Anti-rabbit IgG
  • Purification
    Purification from cell culture supernatant using affinity chromatography followed by buffer exchange with centrifugal columns.
  • Storage Buffer
    PBS, pH 7.4

Delivery

  • Concentration
    0.9–1.1 mg/mL
  • Storage
    Store at 4 °C for up to 1 month. For long-term storage, aliquot and store at -20 °C. Avoid multiple freeze/thaw cycles.
  • Shipment
    Blue ice

Resource Information

  • Persistent Resource Identifier
    RRID:AB_3678702

Terms and Licenses

Target Antigen

Protein Neurexin-1
Antigen Description Purified recombinant fragment of mouse Neurexin-1, corresponding to aa: 28–480.
Antigen Amino Acid Sequence
DYKDDDDKGSGLEFPGAEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLYIDRAEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQALPVDGGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQHSGIGHAMVNKLHCSVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCGSGGLNDIFEAQKIEWHEGSGHHHHHHHH
Species M. musculus (mouse)
Additional Species Reactivity H. sapiens (human)
Alternative Names
  • Neurexin-1-alpha
  • Neurexin I-alpha
  • Neurexin-1a
External References

Applications (1)

Clear filters

Immunocytochemistry

1 image
Immunocytochemistry image by Luís F. Ribeiro, PhD
Submitted By: Luís F. Ribeiro, University of Coimbra
Antibody Type
Recombinant
Target Species
M. musculus (mouse)
Result
Pass

Depositor Comments

Additional characterization data is available for this antibody in the IPI Data Sheet  (Link opens in a new window).

Expected to bind human and mouse antigens based on sequence identity.

The heavy chain and light chain amino acid sequences are available by request after purchase. Please submit requests to [email protected]. For all other questions, please send an email to [email protected] for assistance.

How to cite this antibody ( Back to top)

These antibodies were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the antibodies were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    Anti-Neurexin-1-alpha [IPI-mNRXN1a.40] - from Institute for Protein Innovation (IPI) (Addgene antibody # 237802 ; http://n2t.net/addgene:237802 ; RRID:AB_3678702)
  • For your References section:

Institute for Protein Innovation Logo

IPI Antibody Collection

This antibody was developed by the Institute for Protein Innovation (IPI).

Learn about the IPI Collection