-
Depositing Lab
-
Sequence Information
Ordering
Item | Catalog # | Description | Quantity | Price (USD) | |
---|---|---|---|---|---|
Plasmid | 32466 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $85 |
Backbone
-
Vector backboneCustomized Vector
- Backbone size w/o insert (bp) 4200
-
Vector typeBacterial Expression ; Lab constructed
Growth in Bacteria
-
Bacterial Resistance(s)Ampicillin, 100 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH10B
-
Copy numberLow Copy
Gene/Insert
-
Gene/Insert nameG-GECO1.0
-
Alt namegreen intensiometric genetically encoded Ca2+-indicators for optical imaging version 1.0
-
Insert Size (bp)1251
-
MutationGCaMP3 K119I/L173Q/S404G/E430V
-
GenBank IDJN258413
-
Tags
/ Fusion Proteins
- 6 His tag (N terminal on insert)
- Modified TorA MNNNDLFQASRRRFQAQLGGLTVAGMLGPSLLTPRRATAAQAATDAS. (N terminal on backbone)
Cloning Information
- Cloning method Restriction Enzyme
- 5′ cloning site XbaI (not destroyed)
- 3′ cloning site HindIII (not destroyed)
- 5′ sequencing primer ATGCCATAGCATTTTTATCC
- 3′ sequencing primer GATTTAATCTGTATCAGG (Common Sequencing Primers)
Resource Information
-
Addgene Notes
-
Articles Citing this Plasmid
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
The vector is modified from pBAD/ His B (Invitrogen).
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
pTorPE-G-GECO1 was a gift from Robert Campbell (Addgene plasmid # 32466 ; http://n2t.net/addgene:32466 ; RRID:Addgene_32466) -
For your References section:
An Expanded Palette of Genetically Encoded Ca2+ Indicators. Zhao Y, Araki S, Wu J, Teramoto T, Chang YF, Nakano M, Abdelfattah AS, Fujiwara M, Ishihara T, Nagai T, Campbell RE. Science. 2011 Sep 30;333(6051):1888-91. doi: 10.1126/science.1208592 10.1126/science.1208592 PubMed 21903779