Skip to main content
This website uses cookies to ensure you get the best experience. By continuing to use this site, you agree to the use of cookies.

Please note: Your browser does not support the features used on Addgene's website. You may not be able to create an account or request plasmids through this website until you upgrade your browser. Learn more

Please note: Your browser does not fully support some of the features used on Addgene's website. If you run into any problems registering, depositing, or ordering please contact us at [email protected]. Learn more

Addgene

pUC57 moxDendra2
(Plasmid #89791)

Ordering

Item Catalog # Description Quantity Price (USD)
Plasmid 89791 Standard format: Plasmid sent in bacteria as agar stab 1 $85

This material is available to academics and nonprofits only.

Backbone

  • Vector backbone
    pUC57
  • Vector type
    cloning vector

Growth in Bacteria

  • Bacterial Resistance(s)
    Ampicillin, 100 μg/mL
  • Growth Temperature
    37°C
  • Growth Strain(s)
    DH5alpha
  • Copy number
    Unknown

Gene/Insert

  • Gene/Insert name
    moxDendra2
  • Species
    Synthetic

Terms and Licenses

  • Academic/Nonprofit Terms
  • Industry Terms
    • Not Available to Industry
Trademarks:
  • Zeocin® is an InvivoGen trademark.

Depositor Comments

This construct is engineered with a human codon bias.

Protein sequence of moxDendra2:
MNTPGINLIKEDMRVKVHMEGNVNGHAFVIEGEGKGKPYEGTQTAQLTVKEGAPLPFSYDILTTAVHYGNRVFTKYPEDIPDYFKQSFPEGYSWERTMTFEDKGIATIRSDISLEGDTFFQNVRFKGTNFPPNGPVMQKKTLKWEPSTEKLHVRDGLLVGNINMALLLEGGGHYLADFKTTYKAKKVVQLPDAHFVDHRIEILGQDSDYNKVKLYEHAVARYSPLPSQVW*

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    pUC57 moxDendra2 was a gift from Erik Snapp (Addgene plasmid # 89791 ; http://n2t.net/addgene:89791 ; RRID:Addgene_89791)
  • For your References section:

    moxDendra2: an inert photoswitchable protein for oxidizing environments. Kaberniuk AA, Morano NC, Verkhusha VV, Snapp EL. Chem Commun (Camb). 2017 Feb 9;53(13):2106-2109. doi: 10.1039/c6cc09997a. 10.1039/c6cc09997a PubMed 28133646