We narrowed to 19,561 results for: Comp;
-
Plasmid#137811PurposeIn vivo visualization of actin cytoskeleton (can be used for colocalization studies)DepositorAvailable SinceFeb. 27, 2020AvailabilityAcademic Institutions and Nonprofits only
-
pcDNA5/FRT/TO GFP DNAJA1
Plasmid#19491DepositorAvailable SinceOct. 6, 2008AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
gZiPro
Plasmid#198441PurposeActivity/inhibition assays, 19F-NMRDepositorInsertglycine linked Zika virus NS2B-NS3
TagsHis6-TEVExpressionBacterialMutationR95*A,PromoterT7 promoterAvailable SinceMarch 29, 2023AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1(+)-HLA-Flag-natT1R3
Plasmid#113950Purposemammalian expression plasmid for FLAG-tagged human T1R3 with signal peptide of HLA class I histocompatibility antigen A-2 alpha chainDepositorInsertT1R3 (TAS1R3 Human)
TagsFLAG and Signal/leader sequence from HLA class I …ExpressionMammalianMutationresidues 21-852Available SinceFeb. 8, 2019AvailabilityAcademic Institutions and Nonprofits only -
pMAL-c2X_MBP-LcgcN(C24S)-H6
Plasmid#245527PurposeMaltose binding protein N-terminally fused to His-tagged N-terminal LCGC14 PolB2split intein fragmentDepositorInsertN-terminal Fragment of the LCGC14 Split Intein with C24S Mutation
TagsHexahistidine Tag and Maltose Binding Protein (MB…ExpressionBacterialMutationC24S within the N-terminal fragment of the LCGC14…PromotertacAvailable SinceNov. 19, 2025AvailabilityAcademic Institutions and Nonprofits only -
pDESTmycDICER
Plasmid#19873DepositorAvailable SinceDec. 31, 2008AvailabilityAcademic Institutions and Nonprofits only -
pGS-BacA-21222-SIN3A-3xFLAG
Plasmid#109213PurposeEncodes human full-length SIN3A with a C-terminal 3xFLAG tag to be expressed in a baculovirus/insect cell expression systemDepositorAvailable SinceJuly 29, 2025AvailabilityAcademic Institutions and Nonprofits only -
pCAD130_hIrg1_M154I_pvp008
Plasmid#239117PurposehACOD1 with M154I mutation in E.coli expression vectorDepositorInsertcis-aconitate decarboxylase (ACOD1 Human)
TagsStrepTag-IIExpressionBacterialMutationM154IPromoterT7Available SinceJuly 14, 2025AvailabilityAcademic Institutions and Nonprofits only -
CYFIP1.mCherry
Plasmid#122051PurposeExpresses human CYFIP1 in mammalian cells.DepositorAvailable SinceFeb. 22, 2019AvailabilityAcademic Institutions and Nonprofits only