We narrowed to 14,841 results for: flag
-
Plasmid#154217PurposeLentiviral vector for stable expression of FLAG-TK-GAPDHDepositorInsertGAPDH
UseLentiviralTagsFLAGExpressionMammalianMutationcDNA has been codon optimized for human cell expr…PromoterCMVAvailable SinceOct. 28, 2020AvailabilityAcademic Institutions and Nonprofits only -
pENN.AAV.CB7.CI.PM20D1-flag.WPRE.rBG
Plasmid#132682PurposeAAV plasmid encoding mouse PM20D1 with C-terminal flag tagDepositorInsertPeptidase M20 domain containing 1 (Pm20d1 Mouse)
UseAAVTags6xHIS and FlagPromoterChicken b-actinAvailable SinceNov. 26, 2019AvailabilityAcademic Institutions and Nonprofits only -
pENN.AAV.CB7.CI.CNDP2-flag.WPRE.rBG
Plasmid#132685PurposeAAV plasmid encoding mouse CNDP2 with C-terminal flag tagDepositorAvailable SinceNov. 22, 2019AvailabilityAcademic Institutions and Nonprofits only -
pCDNA3.1-Flag-H2A K5-9R
Plasmid#63562PurposeExpression of human H2A with K5R and K9R tagged with FlagDepositorInsertH2A (H2AC20 Human)
TagsFlag (MDYKDDDDKVPRIQ)ExpressionMammalianMutationLysine 5 and Lysine 9 are now ArgininePromoterCMVAvailable SinceMarch 16, 2015AvailabilityAcademic Institutions and Nonprofits only -
pFRT/FLAG/HA MOV10 D645N
Plasmid#51717Purposeplasmid expresses FLAG/HA-tagged MOV10 D645NDepositorAvailable SinceMarch 20, 2014AvailabilityAcademic Institutions and Nonprofits only -
-
pTRE-Tight-FLAG-CYLD-C601A
Plasmid#60029PurposeCYLD (C601A) catalytic dead under control of Tet promoter with N-terminal FLAG tagDepositorInsertCylindromatosis (CYLD Human)
TagsFLAGExpressionMammalianMutationCysteine 601 changed to AlaninePromoterTREAvailable SinceAug. 13, 2015AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1+FLAG-KrasnatG12D
Plasmid#206842PurposeTo express mouse Kras encoded by native mouse codons and with a G12D mutation with an N-terminal FLAG tag.DepositorInsertKras (Kras Mouse)
TagsFLAGExpressionMammalianMutationchanged Glycine 12 to Aspartic AcidAvailable SinceOct. 3, 2023AvailabilityAcademic Institutions and Nonprofits only -
His-FLAG-Tev_ACTB (beta-actin)
Plasmid#188453PurposeExpress in mammalian cells human beta-actin (ACTB) with N-terminal 6xHis tag, FLAG tag, and TEV protease site.DepositorAvailable SinceOct. 28, 2022AvailabilityAcademic Institutions and Nonprofits only -
pcDNA5-FRT/TO-3*Flag-APEX2 C-term SRSF7
Plasmid#187582PurposeExpress FLAG epitope and APEX2-tagged SRSF7 fusion protein in mammalian cellsDepositorAvailable SinceAug. 11, 2022AvailabilityAcademic Institutions and Nonprofits only -
pcDNA5-FRT/TO-3*Flag-APEX2 C-term NPAT
Plasmid#187585PurposeExpress FLAG epitope and APEX2-tagged NPAT fusion protein in mammalian cellsDepositorAvailable SinceJuly 28, 2022AvailabilityAcademic Institutions and Nonprofits only -
pCMV4a-SIRT6-G60A-FLAG
Plasmid#102323PurposeHuman SIRT6 G60A with FLAG tag for mammalian expressionDepositorInsertSIRT6 (SIRT6 Human)
TagsFLAGExpressionMammalianMutationchanged glycine 60 to alaninePromoterCMVAvailable SinceOct. 12, 2018AvailabilityAcademic Institutions and Nonprofits only -
plenti-CAG-IKZF2-V2-FLAG-IRES-GFP
Plasmid#69049Purposelentiviral expression of IKZF2 variant 2 with FLAG tagDepositorInsertIKZF2 (IKZF2 Human)
UseLentiviralTagsFLAG and IRES-GFPExpressionMammalianMutationsplice variant 2PromoterCAGAvailable SinceOct. 27, 2017AvailabilityAcademic Institutions and Nonprofits only -
Fyv6-NFLAG del103-173
Plasmid#234134PurposeAmino acids 103-173 deleted in Fyv6 with FLAG epitope tag at N-terminusDepositorInsertFyv6
ExpressionYeastMutationC-terminus truncationAvailable SinceMarch 25, 2025AvailabilityAcademic Institutions and Nonprofits only -
Fyv6-NFLAG del134-173
Plasmid#234135PurposeAmino acids 134-173 deleted in Fyv6 with FLAG epitope tag at N-terminusDepositorInsertFyv6
ExpressionYeastMutationC-terminus truncationAvailable SinceMarch 25, 2025AvailabilityAcademic Institutions and Nonprofits only -
FLAG-Ex1-17-deltaP2-PTPN22
Plasmid#195395PurposeMammalian expression of a human PTPN22 mutant (exon 1-17 without the P2 domain) with FLAG tagDepositorInsertPTPN22 (PTPN22 Human)
TagsFLAGExpressionMammalianMutationPTPN22 mutant containing exon 1 to 17 and lacking…Available SinceMarch 13, 2023AvailabilityAcademic Institutions and Nonprofits only -
FLAG-Ex1-17-deltaP1-PTPN22
Plasmid#195388PurposeMammalian expression of a human PTPN22 mutant (exon 1-17 without the P1 domain) with FLAG tagDepositorInsertPTPN22 (PTPN22 Human)
TagsFLAGExpressionMammalianMutationPTPN22 mutant containing exon 1 to 17 and lacking…Available SinceMarch 13, 2023AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pICE-EGFP-FLAG-PSMD2
Plasmid#161917PurposeExpresses human PSMD2 with a N-terminal GFP-FLAG tag. Confers Puromycin resistance. Inducible in T-REx cells.DepositorInsert26S proteasome non-ATPase regulatory subunit 2 (PSMD2 Human)
TagsGFP-FLAGExpressionMammalianPromoterCMVAvailable SinceMay 12, 2022AvailabilityAcademic Institutions and Nonprofits only -
pLII-proUBI10_CKA3-FLAG_termNOS _OLE-RED
Plasmid#238522PurposePlant expression of flag-tagged A. thaliana CK2alpha3; with OLE1-RED markerDepositorAvailable SinceAug. 4, 2025AvailabilityAcademic Institutions and Nonprofits only