We narrowed to 32,151 results for: OMP;
-
Plasmid#207828PurposeFLAG-tagged NRF2-E79Q driven by CMV promoterDepositorAvailable sinceDec. 22, 2023AvailabilityAcademic Institutions and Nonprofits only
-
pSLIK 3xFLAG-MAVS hygro
Plasmid#158634PurposeLentiviral expression vector for an inducible 3xFLAG-tagged MAVS constructDepositorAvailable sinceSept. 22, 2020AvailabilityAcademic Institutions and Nonprofits only -
pET-DUET-1-mRhubarb720-HO
Plasmid#141201PurposeExpresses mRhubarb720 fluorescent protein and heme oxygenaseDepositorInsertsmRhubarb720
heme oxygenase
Tags6x-HisExpressionBacterialMutationR134H, L196Q, T202D, V203I, W309R, Q310A compared…PromoterT7Available sinceAug. 20, 2020AvailabilityAcademic Institutions and Nonprofits only -
pCI-HA3-HPS1
Plasmid#133930PurposeExpresses 3xHA-HPS1 construct in mammalian cellsDepositorAvailable sinceNov. 15, 2019AvailabilityAcademic Institutions and Nonprofits only -
(SUMO)10-(SIM)5
Plasmid#126866PurposeBacterial expression plasmid for multivalent scaffold of (SUMO)10-(SIM)5 biomolecular condensates to recruit SIM-containing client proteins.DepositorInsert10 repeats of human SUMO3 and 5 repeats of human SUMO interactive motif (SIM) from PIASx each separated by (GGS)4 (SUMO3 Human)
ExpressionBacterialPromotertacAvailable sinceNov. 15, 2019AvailabilityAcademic Institutions and Nonprofits only -
pBiex-1 AC30_eGFP
Plasmid#82715PurposeExpresses a GFP-tagged recombinant adenylyl cyclase.DepositorTagsFLAG purification tag and eGFPExpressionBacterial and InsectPromoterT7 PromoterAvailable sinceNov. 3, 2016AvailabilityAcademic Institutions and Nonprofits only -
pcDNA_DiCre_59.F2
Plasmid#60207PurposeExpresses a fusion protein of FKBP12-linker peptide 2- Cre(19-59)DepositorInsertCre recombinase (CD207 Bacteriophage P1, Synthetic, Human)
TagsFKBP12 and Nuclear localisation signalExpressionMammalianMutationamino acids 19-59 of the humanized version of Cre…PromoterCMVAvailable sinceJan. 8, 2015AvailabilityAcademic Institutions and Nonprofits only -
pBS mouse c-Myc
Plasmid#14972DepositorAvailable sinceMay 17, 2007AvailabilityAcademic Institutions and Nonprofits only -
pLVX-Puro-mGFP-WDR34
Plasmid#64251PurposeExpresses WDR34 as a fusion with monomeric GFPDepositorAvailable sinceJuly 28, 2015AvailabilityAcademic Institutions and Nonprofits only -
PRS_8-ChrimsonR-tdTomato
Plasmid#192587PurposeAAV-vector for optogenetic activation of noradrenergic neuronsDepositorInsertChrimsonR
UseAAVTagstdTomatoExpressionMammalianPromoterPRSX8Available sinceDec. 8, 2022AvailabilityAcademic Institutions and Nonprofits only -
3NES-CS(G)-tTA-CS(G)-3NES
Plasmid#137836PurposeSoluble tTA transcription factor flanked by N and C terminal TEV protease G cleavage sequences and 3 nuclear export sequencesDepositorHas service50 µg Transfection-Ready DNA and 100 µg Transfection-Ready DNAInsert3NES-CD(G)-tTA-CS(G)-3NES
ExpressionMammalianPromoterCMVAvailable sinceFeb. 1, 2021AvailabilityAcademic Institutions and Nonprofits only -
pLX-Z4 (GB3375)
Plasmid#160648PurposepLX series: RK2-based T-DNA binary vector for plant transformation (alpha1)DepositorTypeEmpty backboneUseSynthetic BiologyAvailable sinceNov. 30, 2020AvailabilityAcademic Institutions and Nonprofits only -
pAAV-CMV-dSa-VPR mini.-syn pA
Plasmid#99689PurposeExpresses dSa Cas9 fused to optimized combination of truncated activation domains with syn pA (poly adenylation) signalDepositorPublicationInsertdCas9
UseAAVTagsVPR miniMutationdead Cas9Available sinceJan. 16, 2019AvailabilityAcademic Institutions and Nonprofits onlyCited by -
pcDNA3-neo-Strep_Flag_Nterm
Plasmid#102644PurposeEpitope tag n-terminus with SBP-Flag moietyDepositorTypeEmpty backboneTagsSBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPG…ExpressionMammalianAvailable sinceOct. 19, 2017AvailabilityAcademic Institutions and Nonprofits only -
p221k-erTq2CFP
Plasmid#71264PurposeEntry clone containing ER-localized Turqoise2. Can be used to construct transcriptional reporters. For use in plants and compatible with the MultiSite Gateway system.DepositorInsertTq2CFP
UseGateway CloningTagsER retention signal HDEL and signal peptide (ER)…Available sinceJan. 14, 2016AvailabilityAcademic Institutions and Nonprofits onlyCited by -
pBAD/HisD-LSSmKate1
Plasmid#31908DepositorInsertLSSmKate1
TagsHISExpressionBacterialMutationK69Y/P131T/S148G/M167E/T183S/M196V compared to mK…Available sinceSept. 13, 2011AvailabilityAcademic Institutions and Nonprofits only -
pDIV537
Plasmid#177704PurposePlasmid expressing optimized Cas9 and NAT marker and sgRNA targeting KU70 homolog in D. hanseniiDepositorInsertsCas9
Nat
tRNA-sgRNA-tRNA
UseCRISPRTagsSV40ExpressionBacterial and YeastPromoterRNR2p (Debaryomyces hansenii ), TDH3p (Candida lu…Available sinceMarch 11, 2022AvailabilityAcademic Institutions and Nonprofits onlyCited by -
ART
Plasmid#214063PurposeFluorescent reporter system to measure EJC-independent NMD activity. No intron in 5'UTRDepositorHas service50 µg Transfection-Ready DNA and 100 µg Transfection-Ready DNAInsertTurboRFP
ExpressionMammalianMutationLinker sequence present between RFP and GFPAvailable sinceFeb. 23, 2024AvailabilityAcademic Institutions and Nonprofits onlyCited by -
pLVNP2.0-SpCas9
Plasmid#206880PurposeExpresses FLAG-tagged SpCas9 fused to the N-terminus of Gag/GagPol harbouring an intervening phospholipase C-δ1 pleckstrin homology (PH) domainDepositorAvailable sinceOct. 20, 2023AvailabilityAcademic Institutions and Nonprofits only -
pGEMT-PT2A-iRFP670-Tdtomato-GFP
Plasmid#111817PurposeTricistronic construct: Co-express three fluorescent proteins by P2A and then T2ADepositorHas service50 µg Transfection-Ready DNA and 100 µg Transfection-Ready DNAInsertsiRFP670
Tdtomato
GFP
UseCloning intermediateAvailable sinceDec. 18, 2018AvailabilityAcademic Institutions and Nonprofits only