integrin alpha9 pBabe puro
(Plasmid
#13604)
-
Depositing Lab
-
Publication
-
Sequence Information
Full plasmid sequence is not available for this item.
Ordering
| Item | Catalog # | Description | Quantity | Price (USD) | |
|---|---|---|---|---|---|
| Plasmid | 13604 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $89 | |
Backbone
-
Vector backbonepBabe puro
-
Backbone manufacturerAvailable at Addgene (plasmid #1764)
- Backbone size w/o insert (bp) 5169
-
Vector typeMammalian Expression, Retroviral
-
Selectable markersPuromycin
Growth in Bacteria
-
Bacterial Resistance(s)Ampicillin, 100 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Copy numberHigh Copy
Gene/Insert
-
Gene/Insert nameintegrin alpha 9
-
Alt nameITGA9
-
SpeciesH. sapiens (human)
-
Insert Size (bp)3200
-
Mutationcontains mature ITGA9 (aa30-1035 compared to NP_002198.2)
-
GenBank IDNM_002207
-
Entrez GeneITGA9 (a.k.a. ALPHA-RLC, ITGA4L, RLC)
Cloning Information
- Cloning method Restriction Enzyme
- 5′ cloning site HindIII/SnaBI (destroyed during cloning)
- 3′ cloning site XbaI/SnaBI (destroyed during cloning)
- 5′ sequencing primer pBABE-5
- 3′ sequencing primer pBABE-3
- (Common Sequencing Primers)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
See author's map for additional restriction sites.
An ITGA5 signal peptide sequence (MGSRTPESPLHAVQLRWGPRRRPPLLPLLLLLVPPPPRVGG) is present immediately before the start of ITGA9 at amino acid 30.
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
integrin alpha9 pBabe puro was a gift from Dean Sheppard (Addgene plasmid # 13604 ; http://n2t.net/addgene:13604 ; RRID:Addgene_13604)
Map uploaded by the depositor.