Skip to main content
Addgene

Venus-7aa-MAO-pEGFP-C3
(Plasmid #166765)

Ordering

This material is available to academics and nonprofits only.
Item Catalog # Description Quantity Price (USD)
Plasmid 166765 Standard format: Plasmid sent in bacteria as agar stab 1 $89

Backbone

  • Vector backbone
    pEGFP-C3
  • Vector type
    Mammalian Expression
  • Selectable markers
    Neomycin (select with G418)

Growth in Bacteria

  • Bacterial Resistance(s)
    Kanamycin, 50 μg/mL
  • Growth Temperature
    37°C
  • Growth Strain(s)
    DH5alpha
  • Copy number
    High Copy

Gene/Insert

  • Gene/Insert name
    MAO tail anchor
  • Alt name
    Venus-MAO, V-MAO
  • Species
    H. sapiens (human)
  • Entrez Gene
    MAOA (a.k.a. BRNRS, MAO-A)
  • Promoter CMV
  • Tag / Fusion Protein
    • Venus (N terminal on backbone)

Cloning Information

  • Cloning method Restriction Enzyme
  • 5′ cloning site Unknown (unknown if destroyed)
  • 3′ cloning site Unknown (unknown if destroyed)
  • 5′ sequencing primer TGACGCAAATGGGCGGTAGG
  • 3′ sequencing primer TCGCCCTTTGACGTTGGAGTCCAC
  • (Common Sequencing Primers)

Resource Information

  • Supplemental Documents
  • A portion of this plasmid was derived from a plasmid made by
    See gene entry for "Monoamine oxidase-A [Homo sapiens]" See NCBI Reference Sequence: NP_001257387.1. Here we have used only the C-terminal tail anchor sequence.

Terms and Licenses

  • Academic/Nonprofit Terms
  • Industry Terms
    • Not Available to Industry
Trademarks:
  • Zeocin® is an InvivoGen trademark.

Depositor Comments

"WERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS" amino acid targeting sequence, which we refer to as "MAO", for mitochondrial outer membrane targeting. Pearson's correlation of 0.8-0.9 with mitotracker red signal in cells. "7aa" indicates the 7 amino acid flexible linker region between Venus and the ActA targeting signal for mitochondria.

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    Venus-7aa-MAO-pEGFP-C3 was a gift from David Andrews (Addgene plasmid # 166765 ; http://n2t.net/addgene:166765 ; RRID:Addgene_166765)