Venus-7aa-MAO-pEGFP-C3
(Plasmid
#166765)
-
PurposeTo target Venus to the mitochondrial outer membrane. MAO tail anchor inserts into the outer membrane and Venus faces the cytosol. Serves as a collisional control in FLIM-FRET experiments.
-
Depositing Lab
-
Publication
-
Sequence Information
Ordering
Item | Catalog # | Description | Quantity | Price (USD) | |
---|---|---|---|---|---|
Plasmid | 166765 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $85 |
This material is available to academics and nonprofits only.
Backbone
-
Vector backbonepEGFP-C3
-
Vector typeMammalian Expression
-
Selectable markersNeomycin (select with G418)
Growth in Bacteria
-
Bacterial Resistance(s)Kanamycin, 50 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Copy numberHigh Copy
Gene/Insert
-
Gene/Insert nameMAO tail anchor
-
Alt nameVenus-MAO, V-MAO
-
SpeciesH. sapiens (human)
-
Entrez GeneMAOA (a.k.a. BRNRS, MAO-A)
- Promoter CMV
-
Tag
/ Fusion Protein
- Venus (N terminal on backbone)
Cloning Information
- Cloning method Restriction Enzyme
- 5′ cloning site Unknown (unknown if destroyed)
- 3′ cloning site Unknown (unknown if destroyed)
- 5′ sequencing primer TGACGCAAATGGGCGGTAGG
- 3′ sequencing primer TCGCCCTTTGACGTTGGAGTCCAC (Common Sequencing Primers)
Resource Information
-
Supplemental Documents
-
A portion of this plasmid was derived from a plasmid made bySee gene entry for "Monoamine oxidase-A [Homo sapiens]" See NCBI Reference Sequence: NP_001257387.1. Here we have used only the C-terminal tail anchor sequence.
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
"WERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS" amino acid targeting sequence, which we refer to as "MAO", for mitochondrial outer membrane targeting. Pearson's correlation of 0.8-0.9 with mitotracker red signal in cells. "7aa" indicates the 7 amino acid flexible linker region between Venus and the ActA targeting signal for mitochondria.
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
Venus-7aa-MAO-pEGFP-C3 was a gift from David Andrews (Addgene plasmid # 166765 ; http://n2t.net/addgene:166765 ; RRID:Addgene_166765)