Skip to main content
This website uses cookies to ensure you get the best experience. By continuing to use this site, you agree to the use of cookies.

Please note: Your browser does not support the features used on Addgene's website. You may not be able to create an account or request plasmids through this website until you upgrade your browser. Learn more

Please note: Your browser does not fully support some of the features used on Addgene's website. If you run into any problems registering, depositing, or ordering please contact us at [email protected]. Learn more

Addgene

Anti-GFP [N86/38.1R]
(Antibody #180084)

Ordering

Item Catalog # Description Quantity Price (USD)
Recombinant Antibody 180084-rAb 100 µg of purified recombinant antibody $250 *
Recombinant Antibody trial size 180084-rAb.T 20 µg of purified recombinant antibody $85 *

* Login to view industry pricing.

Features

Production & Usage

  • Production Plasmid
    Anti-GFP [N86/38.1R]
  • Antigen Plasmid
    pAAV-CAG-GFP
  • Purification
    Purified from cell culture supernatant using Protein A or Protein G affinity columns followed by a buffer exchange with centrifugal columns.
  • Storage Buffer
    PBS + 1 mM sodium azide

Delivery

  • Concentration
    0.9–1.1 mg/mL
  • Storage
    Upon receipt, prepare single use aliquots and store at -20 °C until use. Avoid multiple freeze thaw cycles.
  • Shipment
    Blue ice or room temp

Resource Information

  • Persistent Resource Identifier
    RRID:AB_2750819

Terms and Licenses

Target Antigen

Protein Green fluorescent protein
Antigen Description Amino acids 1–238 (full-length) of jellyfish green fluorescent protein
Antigen Amino Acid Sequence
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
Species Synthetic
External References

Applications (1)

Clear filters

Western Blot

2 images
Western Blot image by UC Davis/NIH NeuroMab Facility
Submitted By: UC Davis/NIH NeuroMab Facility
Antibody Type
Hybridoma
Sample Species
Other
Result
Pass
How to cite this antibody ( Back to top)

These antibodies were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the antibodies were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    Anti-GFP [N86/38.1R] - from James Trimmer (Addgene antibody # 180084 ; http://n2t.net/addgene:180084 ; RRID:AB_2750819)
  • For your References section:

    A toolbox of IgG subclass-switched recombinant monoclonal antibodies for enhanced multiplex immunolabeling of brain. Andrews NP, Boeckman JX, Manning CF, Nguyen JT, Bechtold H, Dumitras C, Gong B, Nguyen K, van der List D, Murray KD, Engebrecht J, Trimmer JS. Elife. 2019 Jan 22;8. pii: 43322. doi: 10.7554/eLife.43322. 10.7554/eLife.43322 PubMed 30667360