Skip to main content
Addgene

Anti-PV [BCN14.1.1A2]
(Antibody #217650)

Ordering

Item Catalog # Description Quantity Price (USD)
Recombinant Antibody 217650-rAb 100 µg of purified recombinant antibody $250 *
Recombinant Antibody trial size 217650-rAb.T 20 µg of purified recombinant antibody $85 *

* Log in to view industry pricing.

Features

Production & Usage

  • Purification
    Purified from cell culture supernatant using affinity chromatography followed by a buffer exchange with centrifugal columns.
  • Storage Buffer
    PBS + 1 mM sodium azide

Delivery

  • Concentration
    0.9–1.1 mg/mL
  • Storage
    Upon receipt, prepare single use aliquots and store at -20 °C until use. Avoid multiple freeze thaw cycles.
  • Shipment
    Blue ice

Terms and Licenses

Target Antigen

Protein Parvalbumin alpha
Antigen Description Full length recombinant protein of human PVALB produced in yeast
Antigen Amino Acid Sequence
MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES
Species H. sapiens (human)
Additional Species Reactivity R. norvegicus (rat)
Gene PVALB
External References

Addgene Comments

How to cite this antibody ( Back to top)

These antibodies were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the antibodies were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    Anti-PV [BCN14.1.1A2] - from CDI Laboratories Inc (CDI), Melina Fan (Addgene antibody # 217650 ; http://n2t.net/addgene:217650)
  • For your References section: