-
Depositing Lab
-
Depositing OrganizationNational Cancer Institute (NCI)
Located in United States of America -
Publication
-
Citations
-
Sequence Information
Ordering
| Item | Catalog # | Description | Quantity | Price (USD) | |
|---|---|---|---|---|---|
| Plasmid | 33371 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $94 | |
| DNA | 33371-D50 | 50 μg of DNA in Tris buffer | $495 | ||
| DNA | 33371-D100 | 100 μg of DNA in Tris buffer | $585 | ||
Backbone
-
Vector backboneCMV500
- Backbone size w/o insert (bp) 5500
-
Vector typeMammalian Expression
Growth in Bacteria
-
Bacterial Resistance(s)Ampicillin, 100 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Copy numberHigh Copy
Gene/Insert
-
Gene/Insert nameCREB
-
Alt nameAcidic cAMP Response Element Binding Protein
-
Alt nameA-CREB
-
SpeciesM. musculus (mouse)
-
MutationDominant Negative (see notes)
-
GenBank IDNM_133828
-
Entrez GeneCreb1 (a.k.a. 2310001E10Rik, 3526402H21Rik, Creb, Creb-1)
- Promoter CMV
-
Tag
/ Fusion Protein
- FLAG (N terminal on insert)
Cloning Information
- Cloning method Restriction Enzyme
- 5′ cloning site NdeI (not destroyed)
- 3′ cloning site HindIII (not destroyed)
- 5′ sequencing primer CMV-Fwd
- 3′ sequencing primer BGH-Rev
- (Common Sequencing Primers)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
A-CREB aa sequence: DYKDDDDK-MASMTGGQQMGRDPDLEQRAEELARENEELEKEAEELEQELAELENRVAVLENQNKTLIEELKALKDLYCHKSD. The first 8 aa encode for the FLAG tag, the next 13 aa area a φ10 protein sequence, the next 31 aa are the amphipathic acidic extension, and the final group of aa are the mouse CREB leucine zipper, which continues to the natural C terminus of the protein.
DNA (Catalog # 33371-D50)
Purpose
Ready-to-use, high-purity DNA prep. DNA aliquots are suitable for use in mammalian cell transfections and other molecular biology applications.
Delivery
- Amount 50 μg
- Concentration 1 μg/μL
- Pricing $495 USD
- Storage 4 ℃ (short-term) or -20 ℃ (long-term)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Quality Control
Every DNA prep is verified by next-generation sequencing, confirming plasmid identity, sequence integrity, and absence of DNA contaminants. Concentration is confirmed to be within ±2.5% of the stated concentration.
Our production process has been validated to consistently yield endotoxin levels below 1.0 EU/μg. Individual lots are not tested for endotoxin.
DNA (Catalog # 33371-D100)
Purpose
Ready-to-use, high-purity DNA prep. DNA aliquots are suitable for use in mammalian cell transfections and other molecular biology applications.
Delivery
- Amount 100 μg
- Concentration 1 μg/μL
- Pricing $585 USD
- Storage 4 ℃ (short-term) or -20 ℃ (long-term)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Quality Control
Every DNA prep is verified by next-generation sequencing, confirming plasmid identity, sequence integrity, and absence of DNA contaminants. Concentration is confirmed to be within ±2.5% of the stated concentration.
Our production process has been validated to consistently yield endotoxin levels below 1.0 EU/μg. Individual lots are not tested for endotoxin.
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
CMV500 A-CREB was a gift from Charles Vinson (Addgene plasmid # 33371 ; http://n2t.net/addgene:33371 ; RRID:Addgene_33371) -
For your References section:
A dominant-negative inhibitor of CREB reveals that it is a general mediator of stimulus-dependent transcription of c-fos. Ahn S, Olive M, Aggarwal S, Krylov D, Ginty DD, Vinson C. Mol Cell Biol. 1998 Feb . 18(2):967-77. PubMed 9447994
Map uploaded by the depositor.
