pC-FLAG-ZCD2
(Plasmid
#79274)
-
PurposeMammalian expression of ZCD2 with a C-terminal FLAG tag
-
Depositing Lab
-
Sequence Information
Full plasmid sequence is not available for this item.
Ordering
| Item | Catalog # | Description | Quantity | Price (USD) | |
|---|---|---|---|---|---|
| Plasmid | 79274 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $89 * | |
* Log in to view industry pricing.
Backbone
-
Vector backbonepDEST26-C-FLAG
- Backbone size w/o insert (bp) 7500
-
Vector typeMammalian Expression
-
Selectable markersNeomycin (select with G418)
Growth in Bacteria
-
Bacterial Resistance(s)Ampicillin, 100 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Copy numberHigh Copy
Gene/Insert
-
Gene/Insert nameZCD2
-
SpeciesH. sapiens (human)
-
Entrez GeneCISD2 (a.k.a. ERIS, Miner1, NAF-1, WFS2, ZCD2)
- Promoter CMV
-
Tag
/ Fusion Protein
- FLAG (C terminal on backbone)
Cloning Information
- Cloning method Gateway Cloning
- 5′ sequencing primer CMV-F
- 3′ sequencing primer M13-F20 (Common Sequencing Primers)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
Please note that the amino acid sequence LKEPIQSTGSGTEFPGYRRPTRPGSGEEWTPLAR is inserted before the start of the ZCD2 sequence. The depositor noted that this sequence does NOT affect plasmid function.
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
pC-FLAG-ZCD2 was a gift from Rita Shiang (Addgene plasmid # 79274 ; http://n2t.net/addgene:79274 ; RRID:Addgene_79274) -
For your References section:
A homozygous mutation in a novel zinc-finger protein, ERIS, is responsible for Wolfram syndrome 2. Amr S, Heisey C, Zhang M, Xia XJ, Shows KH, Ajlouni K, Pandya A, Satin LS, El-Shanti H, Shiang R. Am J Hum Genet. 2007 Oct;81(4):673-83. Epub 2007 Aug 20. 10.1086/520961 PubMed 17846994