pUC57 moxDendra2
              
              
                (Plasmid
                
                #89791)
              
            
            
            
          - 
            Purposebacterial expression of moxDendra2
- 
              Depositing Lab
- 
          Sequence Information
Ordering
| Item | Catalog # | Description | Quantity | Price (USD) | |
|---|---|---|---|---|---|
| Plasmid | 89791 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $89 | |
Backbone
- 
            Vector backbonepUC57
- 
              Vector typecloning vector
Growth in Bacteria
- 
            Bacterial Resistance(s)Ampicillin, 100 μg/mL
- 
            Growth Temperature37°C
- 
            Growth Strain(s)DH5alpha
- 
            Copy numberUnknown
Gene/Insert
- 
                Gene/Insert namemoxDendra2
- 
                    SpeciesSynthetic
Terms and Licenses
- 
        Academic/Nonprofit Terms
- 
      Industry Terms- Not Available to Industry
 
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
This construct is engineered with a human codon bias.
Protein sequence of moxDendra2:
MNTPGINLIKEDMRVKVHMEGNVNGHAFVIEGEGKGKPYEGTQTAQLTVKEGAPLPFSYDILTTAVHYGNRVFTKYPEDIPDYFKQSFPEGYSWERTMTFEDKGIATIRSDISLEGDTFFQNVRFKGTNFPPNGPVMQKKTLKWEPSTEKLHVRDGLLVGNINMALLLEGGGHYLADFKTTYKAKKVVQLPDAHFVDHRIEILGQDSDYNKVKLYEHAVARYSPLPSQVW*
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
- 
              For your Materials & Methods section: pUC57 moxDendra2 was a gift from Erik Snapp (Addgene plasmid # 89791 ; http://n2t.net/addgene:89791 ; RRID:Addgene_89791)
- 
                For your References section: moxDendra2: an inert photoswitchable protein for oxidizing environments. Kaberniuk AA, Morano NC, Verkhusha VV, Snapp EL. Chem Commun (Camb). 2017 Feb 9;53(13):2106-2109. doi: 10.1039/c6cc09997a. 10.1039/c6cc09997a PubMed 28133646
