We narrowed to 12,130 results for: LEA
-
Plasmid#160499PurposeFor the expression of human P2X3 with ALFA tag at C-terminus in mammalian cellsDepositorInserthuman P2X3 (P2RX3 Human, Synthetic)
TagsHRV3C protease cleavage site-ALFA tag-twin Strep …ExpressionMammalianMutationΔN5ΔC33-T13P/S15V/V16IAvailable SinceJan. 4, 2021AvailabilityAcademic Institutions and Nonprofits only -
pLVX-EF1a-EGFP-Membrin-IRES-Puromycin
Plasmid#134865PurposeExpresses EGFP-tagged Golgi apparatus markerDepositorAvailable SinceMarch 3, 2020AvailabilityAcademic Institutions and Nonprofits only -
NES-EGFP-cPHx2
Plasmid#116854PurposePI(3,4)P2 biosensorDepositorInsertPLEKHA1 (PLEKHA1 Human)
TagsEGFP and X.leavis map2k1.L(32-44)ExpressionMammalianMutationamino acids 169-329 (tandem dimer)Available SinceOct. 11, 2018AvailabilityAcademic Institutions and Nonprofits only -
RINS1(mut)
Plasmid#107291PurposePlasmid for the expression of the inactive mutant of RINS1 sensorDepositorInsertRINS1(mut)
TagssfGFPExpressionMammalianMutationtwo Arg/Ser mutations at the beginning and in the…PromoterCMVAvailable SinceMay 1, 2018AvailabilityAcademic Institutions and Nonprofits only -
pOTTC414 - pAAV EF1a hPREP
Plasmid#59967PurposeAn AAV packaging vector that expresses hPREP under control of the EF1a promoter.DepositorAvailable SinceOct. 8, 2014AvailabilityAcademic Institutions and Nonprofits only -
FLAG-Pol-II CC
Plasmid#35180DepositorInsertRPBI (POLR2A Human)
TagsFLAGExpressionMammalianMutationContains C-terminal domain repeats (1-22)X2PromoterCMVAvailable SinceMarch 30, 2012AvailabilityAcademic Institutions and Nonprofits only -
pEGFP-C1-PRKAA1ΔC
Plasmid#30306DepositorInsertAMP-activated Protein Kinase α1 ΔC (Prkaa1 Rat)
TagsGFPExpressionMammalianMutationdeleted amino acids Pro 526 to Gln 548Available SinceAug. 26, 2011AvailabilityAcademic Institutions and Nonprofits only -
10xHis-TEV-ATG5_ATG7_ATG10_ATG12_ATG16L1-TEV-mGFP-StrepII (Human autophagy E3(mGFP)-like enzyme)
Plasmid#169077PurposeInsect codon optimized ATG genes (excluded tags): 10xHis-TEV-ATG5, ATG7, ATG10, ATG12 and ATG16L1-GFP-TEV-StrepIIDepositorInsertsTagsGFP tag, GGlinker, TEV cleavage site. StrepII and…ExpressionBacterial and InsectPromoterPolyhedrin promoterAvailable SinceMay 6, 2021AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-ABKAR(T/A)
Plasmid#140052PurposeNegative control mutant for ABKAR biosensor.DepositorInsertABKAR(T/A)
Tags6xHIS - T7 tag (gene 10 leader) - Xpress (TM) tag…ExpressionMammalianMutationTarget Thr residue in substrate domain mutated to…PromoterCMVAvailable SinceNov. 21, 2020AvailabilityAcademic Institutions and Nonprofits only -
pUB-nSypHer (NLS:sypHer:NLS)
Plasmid#84731PurposeExpresses sypHer in plant cells-biosensor for pH targeted to NucleiDepositorInsertnSypHer
TagsNLS (nuclear localisation signal and NLS (nuclear…ExpressionPlantPromoterubiqutin- 10 gene promoter (pUBQ10) of ArabidopsisAvailable SinceJuly 6, 2017AvailabilityAcademic Institutions and Nonprofits only -
SUMO_TwinStrep_Cas7-11_crRNA
Plasmid#197612PurposeFor protein purification of Cas7-11DepositorInsertSUMO_TwinStrep_Cas7-11 with crRNA
ExpressionBacterialAvailable SinceAug. 21, 2023AvailabilityAcademic Institutions and Nonprofits only -
pAAV-Ef1a-fDIO EYFP (AAV Retrograde)
Viral Prep#55641-AAVrgPurposeReady-to-use AAV Retrograde particles produced from pAAV-Ef1a-fDIO EYFP (#55641). In addition to the viral particles, you will also receive purified pAAV-Ef1a-fDIO EYFP plasmid DNA. EF1a-driven, Flp-dependent expression of EYFP. These AAV were produced with a retrograde serotype, which permits retrograde access to projection neurons. These AAV preparations are suitable purity for injection into animals.DepositorPromoterEF1aTagsEYFP (Flp-dependent)Available SinceOct. 21, 2024AvailabilityAcademic Institutions and Nonprofits only -
pBK092
Plasmid#183146PurposepET-6xHis-MBP-TEV-CrtTIR-APAZ/CrtAgo - Heterologous CrtSPARTA expressionDepositorInsertCrtSPARTA operon (6xHis-MBP-CrtTIR-APAZ and CrtAgo)
Tags6xHis and MBPExpressionBacterialPromoterT7Available SinceApril 21, 2022AvailabilityAcademic Institutions and Nonprofits only -
DiLiCre 2.0
Plasmid#198752PurposeA Cre recombinase that is expressed upon doxycycline when combined with the UbC-blasticidine-P2A-TETon-3G transactivator. DiLiCre 2.0 is a cre recombinase that is activated by violet light.DepositorInsertCre-PhoCI-ERT2-ERT2
UseLentiviralTagsCre, kept in a photocleavable site, followed by 2…ExpressionBacterial and MammalianPromoterTRE3GVAvailable SinceJuly 7, 2023AvailabilityAcademic Institutions and Nonprofits only -
pcDNA5-FRT/TO-3*Flag-APEX2 N-term NONO
Plasmid#187580PurposeExpress FLAG epitope and APEX2-tagged NONO fusion protein in mammalian cellsDepositorAvailable SinceJuly 28, 2022AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pVoPo-02
Plasmid#187837PurposeBackbone for translational reporter system in Fusobacterium nucleatumDepositorTypeEmpty backboneExpressionBacterialAvailable SinceSept. 6, 2023AvailabilityAcademic Institutions and Nonprofits only -
HA-BACE1-mBFP
Plasmid#196697PurposeExpresses Bace1 with an HA tag at N-terminal for single molecule tracking and other measusers in mammalian cellsDepositorAvailable SinceApril 26, 2023AvailabilityAcademic Institutions and Nonprofits only -
pET28a-TEV-TBP6.9F34MF37MF77M
Plasmid#168268PurposeExpresses human TBP6.9 with the F34M/F37M/F77M triple mutantDepositorInsertTBP6.9
Tags6xHis tag N-terminus, TEV protease cleavage siteExpressionBacterialMutationchanged F34M, F37M and F77MPromoterT7 promotorAvailable SinceApril 16, 2021AvailabilityAcademic Institutions and Nonprofits only -
pMINTC3H
Plasmid#110075PurposeAnalogous to pMINTNH3 but with a C-terminal 3C cleavage site and His10 tag.DepositorTypeEmpty backboneTags3C cleavage site - His10 TagExpressionBacterialAvailable SinceJune 5, 2018AvailabilityAcademic Institutions and Nonprofits only