We narrowed to 44,516 results for: INA
-
Plasmid#12830PurposeThis plasmid was designed for screening purposes and may contain discrepancies relative to the current canonical GenBank version of the gene.DepositorInsertVV.Orf142
ExpressionMammalianAvailable SinceDec. 8, 2006AvailabilityAcademic Institutions and Nonprofits only -
DCT.VV.Orf91
Plasmid#12779PurposeThis plasmid was designed for screening purposes and may contain discrepancies relative to the current canonical GenBank version of the gene.DepositorInsertVV.Orf91
ExpressionMammalianAvailable SinceDec. 6, 2006AvailabilityAcademic Institutions and Nonprofits only -
DCT.VV.Orf34
Plasmid#12722PurposeThis plasmid was designed for screening purposes and may contain discrepancies relative to the current canonical GenBank version of the gene.DepositorInsertVV.Orf34
ExpressionMammalianAvailable SinceDec. 1, 2006AvailabilityAcademic Institutions and Nonprofits only -
pUCmini-iCAP-PHP.eB
Plasmid#103005Purposenon-standard AAV2 rep-AAV-PHP.eB cap plasmid with AAV cap expression controlled by a tTA-TRE amplification systemDepositorInsertSynthetic construct isolate AAV-PHP.eB VP1 gene
UseAAVExpressionMammalianPromoterp41Available SinceMarch 29, 2018AvailabilityAcademic Institutions and Nonprofits only -
pUCmini-iCAP-PHP.S
Plasmid#103006Purposenon-standard AAV2 rep-AAV-PHP.S cap plasmid with AAV cap expression controlled by a tTA-TRE amplification systemDepositorInsertSynthetic construct isolate AAV-PHP.S VP1 gene
UseAAVExpressionMammalianPromoterp41Available SinceFeb. 7, 2018AvailabilityAcademic Institutions and Nonprofits only -
pNP3386 [For use in genome insertion and off-target assessment]
Plasmid#247258PurposeExample plasmid for bridge recombinase mediated insertion and off-target assessment with puromycin selection — must clone in UMIDepositorInsertISCro4 Recognition Site-UMI-Ef1a-PuroR-P2A-mCherry (Plasmid for Insertion Site Mapping [Example, Clone in Sequence + UMI])
ExpressionMammalianAvailable SinceOct. 23, 2025AvailabilityAcademic Institutions and Nonprofits only -
pPW3758 : CMVd3-HsIRE1-HaloTag
Plasmid#185680PurposeLow-level transient expression of full-length HsIRE1 with a C-terminal HaloTag.DepositorInsertERN1 (ERN1 Human, Synthetic)
ExpressionMammalianAvailable SinceMarch 14, 2023AvailabilityAcademic Institutions and Nonprofits only -
LentiV_Neo_SIK3_CR_K95M
Plasmid#108106PurposeLentiviral expression plasmid of human SIK3 cDNA (CRISPR-resistant silent mutation & kinase-dead mutation) with neomycin resistance geneDepositorInsertSIK3 (SIK3 Human)
UseCRISPR and LentiviralExpressionMammalianMutationchange guanine 501 to cytosine (silent mutation),…PromoterEFS promoterAvailable SinceApril 5, 2018AvailabilityAcademic Institutions and Nonprofits only -
7M8
Plasmid#64839PurposeThis plasmid can be used in the triple transfection method of AAV vector production. It supplies the replication proteins from AAV2 and the 7M8 capsid protein.DepositorInsert7M8 cap
UseAAVMutation7mer insertion in the AAV2 capAvailable SinceAug. 3, 2015AvailabilityAcademic Institutions and Nonprofits only -
pFB1.HMBP.PrS.PHF19
Plasmid#125168PurposeExpresses human PHF19 in insect cells, , under a C3-cleavable (PreScission Protease) N-terminal hexahistidine-MBP tag.DepositorAvailable SinceApril 27, 2020AvailabilityAcademic Institutions and Nonprofits only -
pAAV-TPH2-Cre
Plasmid#189616PurposeExpresses Cre recombinase under the control of the tryptophan hydroxylase promoterDepositorInsertCre Recombinase
UseAAVExpressionMammalianPromoterTph2Available SinceMarch 15, 2023AvailabilityAcademic Institutions and Nonprofits only -
pT7-hMLH1dn for IVT
Plasmid#178114PurposeTemplate for in vitro transcription of human MLH1dnDepositorInserthuman MLH1dn (codon optimized) (MLH1 Human)
UseTemplate for in vitro transcriptionMutationDetailed in manuscriptPromoterT7 (inactivated)Available SinceNov. 30, 2021AvailabilityAcademic Institutions and Nonprofits only -
pTwist-SFFV-NFE2L18ND-Puro
Plasmid#181918PurposeLentiviral plasmid that directs the expression of mutant NFE2L1/Nrf1 where 8 putative N-glycosites are mutated from asparagine to aspartic acid in mammalian cells.DepositorInsertNFE2L1 (NFE2L1 Human)
UseLentiviralTagsFLAG and HAExpressionMammalianMutation8 putative N-glycoyslation sites converted from a…PromoterSFFVAvailable SinceApril 6, 2022AvailabilityAcademic Institutions and Nonprofits only -
pMSCV mKeima-LC3
Plasmid#189006PurposeFluorescent reporter for autophagyDepositorInsertmKeima, LC3 (Map1lc3b Rat)
UseRetroviralAvailable SinceSept. 8, 2022AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pORTMAGE-4
Plasmid#72679PurposeExpresses Lambda Red recombinases and a dominant negative MutL allele all controlled by temperature sensitve cI857 repressor for high precision and efficiency MAGE experiments. Cam resistance marker.DepositorInsertmutL E32K
TagsnoneExpressionBacterialMutationE32K mutation conferring dominant mutator phenoty…Available SinceFeb. 18, 2016AvailabilityAcademic Institutions and Nonprofits only -
FASTHDR-Cterm-HaloTag-Puromycin
Plasmid#167208PurposePlasmid to clone recombination arms to create homologous recombination donor vector for C-terminal gene tagging with HaloTag and selection with PuromycinDepositorTypeEmpty backboneUseCRISPRTagsHaloTagExpressionMammalianAvailable SinceDec. 8, 2021AvailabilityAcademic Institutions and Nonprofits only -
pIVT_goldDn29-dCas9-P2A-GFP
Plasmid#247167PurposeIn vitro transcription of human codon optimized fusion of goldDn29-dCas9-P2A-GFPDepositorInsertgoldDn29-dCas9-P2A-GFP
UseIn vitro transcriptionTagsSV40 NLSMutationM6I/E70G/A224P/G227V/Q332K/N341K/L393P/D503NPromotermutated T7Available SinceNov. 12, 2025AvailabilityAcademic Institutions and Nonprofits only -
pTT3 Unc5D-FLAG
Plasmid#72197PurposeExpresses full-length Unc5d with a C-terminal FLAG tagDepositorAvailable SinceMay 30, 2018AvailabilityAcademic Institutions and Nonprofits only -
pLenti-mCherry-Cre-blast
Plasmid#179390PurposeLentiviral expression of Cre recombinase and mCherry reporter from CMV promoter (separated by P2A peptide), and blasticidin resistance gene for selection in mammalian cells.DepositorInsertmCherry (P2A) Cre recombinase
UseCre/Lox and LentiviralExpressionMammalianPromoterCMVAvailable SinceFeb. 22, 2022AvailabilityAcademic Institutions and Nonprofits only