Skip to main content
This website uses cookies to ensure you get the best experience. By continuing to use this site, you agree to the use of cookies.

Please note: Your browser does not support the features used on Addgene's website. You may not be able to create an account or request plasmids through this website until you upgrade your browser. Learn more

Please note: Your browser does not fully support some of the features used on Addgene's website. If you run into any problems registering, depositing, or ordering please contact us at [email protected]. Learn more

Addgene

Anti-CASPR/Neurexin IV [K65/35R]
(Antibody #182999)

Ordering

Item Catalog # Description Quantity Price (USD)
Recombinant Antibody 182999-rAb 100 µg of purified recombinant antibody $250 *
Recombinant Antibody trial size 182999-rAb.T 20 µg of purified recombinant antibody $85 *

* Login to view industry pricing.

Features

Production & Usage

  • Production Plasmid
    Anti-CASPR/Neurexin IV [K65/35R]
  • Purification
    Purified from cell culture supernatant using Protein A or Protein G affinity columns followed by a buffer exchange with centrifugal columns.
  • Storage Buffer
    PBS + 1 mM sodium azide

Delivery

  • Concentration
    0.9–1.1 mg/mL
  • Storage
    Upon receipt, prepare single use aliquots and store at -20 °C until use. Avoid multiple freeze thaw cycles.
  • Shipment
    Blue ice or room temp

Resource Information

  • Persistent Resource Identifier
    RRID:AB_2909546

Terms and Licenses

Target Antigen

Protein Contactin-associated protein 1
Antigen Description Amino acids 1308–1381 (cytoplasmic domain) of rat Caspr
Antigen Amino Acid Sequence
QNHRYKGSYHTNEPKATHDSHPGGKAPLPPSGPAQAPAPTPAPTQVPTPAPAPASGPGPRDQNLPQILEESRSE
Species R. norvegicus (rat)
Additional Species Reactivity H. sapiens (human),  M. musculus (mouse)
Gene Cntnap1
Alternative Names
  • Neurexin IV
  • Neurexin-4
  • Paranodin
  • p190
External References

Applications (2)

Clear filters

Immunohistochemistry

1 image
Immunohistochemistry image by James Trimmer, UC Davis
Submitted By: James Trimmer, UC Davis
Addgene Partner
Antibody Type
Recombinant
Sample Species
R. norvegicus (rat)
Result
Pass
1 image
Immunohistochemistry image by UC Davis/NIH NeuroMab Facility
Submitted By: UC Davis/NIH NeuroMab Facility
Antibody Type
Hybridoma
Sample Species
R. norvegicus (rat)
Result
Pass
How to cite this antibody ( Back to top)

These antibodies were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the antibodies were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    Anti-CASPR/Neurexin IV [K65/35R] - from James Trimmer (Addgene antibody # 182999 ; http://n2t.net/addgene:182999 ; RRID:AB_2909546)
  • For your References section:

    High-volume hybridoma sequencing on the NeuroMabSeq platform enables efficient generation of recombinant monoclonal antibodies and scFvs for neuroscience research. Mitchell KG, Gong B, Hunter SS, Burkart-Waco D, Gavira-O'Neill CE, Templeton KM, Goethel ME, Bzymek M, MacNiven LM, Murray KD, Settles ML, Froenicke L, Trimmer JS. Sci Rep. 2023 Sep 27;13(1):16200. doi: 10.1038/s41598-023-43233-4. 10.1038/s41598-023-43233-4 PubMed 37758930