Skip to main content

8xGliBS-IVS2-mCherry-NLS-Odc1-polyA-Tol2
(Plasmid #84603)

Ordering

This material is available to academics and nonprofits only.
Item Catalog # Description Quantity Price (USD)
Plasmid 84603 Standard format: Plasmid sent in bacteria as agar stab 1 $89

Backbone

  • Vector backbone
    pT2KXIG
  • Backbone manufacturer
    K. Kawakami lab
  • Vector type
    Zebrafish transgenesis

Growth in Bacteria

  • Bacterial Resistance(s)
    Ampicillin, 100 μg/mL
  • Growth Temperature
    37°C
  • Growth Strain(s)
    DH5alpha
  • Copy number
    Unknown

Gene/Insert

  • Gene/Insert name
    mCherry
  • Species
    Synthetic
  • Promoter 8xGliBS-delta-crystallin minimal promoter
  • Tag / Fusion Protein
    • ODC1 destabilizing element (C terminal on insert)

Cloning Information

  • Cloning method Restriction Enzyme
  • 5′ cloning site XhoI (not destroyed)
  • 3′ cloning site EcoRI (not destroyed)
  • 5′ sequencing primer pBluescript-SK
  • 3′ sequencing primer unknown
  • (Common Sequencing Primers)

Resource Information

  • A portion of this plasmid was derived from a plasmid made by
    mCherry from pRSET-mCherry (R. Tsien); 8xGliBS-delta-crystallin from 8xGliBS-Luciferase (H. Kondoh), Odc1 from d1EGFP (Clontech)
  • Article Citing this Plasmid

Terms and Licenses

Trademarks:

  • Zeocin® is an InvivoGen trademark.

Depositor Comments

The amino acid sequence of the Odc1-derived destabilizing element is: SHGFPPAVAAQDDGTLPMSCAQESGMDRHPAACASARINV.

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    8xGliBS-IVS2-mCherry-NLS-Odc1-polyA-Tol2 was a gift from James Chen (Addgene plasmid # 84603 ; http://n2t.net/addgene:84603 ; RRID:Addgene_84603)
  • For your References section:

    In vivo imaging of Hedgehog pathway activation with a nuclear fluorescent reporter. Mich JK, Payumo AY, Rack PG, Chen JK. PLoS One. 2014 Jul 28;9(7):e103661. doi: 10.1371/journal.pone.0103661. eCollection 2014. PONE-D-14-13224 [pii] PubMed 25068273