8xGliBS-IVS2-mCherry-NLS-Odc1-polyA-Tol2
(Plasmid
#84603)
-
PurposeTol2-based hedgehog signal reporter plasmid for zebrafish transgenesis
-
Depositing Lab
-
Sequence Information
Ordering
| Item | Catalog # | Description | Quantity | Price (USD) | |
|---|---|---|---|---|---|
| Plasmid | 84603 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $89 | |
Backbone
-
Vector backbonepT2KXIG
-
Backbone manufacturerK. Kawakami lab
-
Vector typeZebrafish transgenesis
Growth in Bacteria
-
Bacterial Resistance(s)Ampicillin, 100 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Copy numberUnknown
Gene/Insert
-
Gene/Insert namemCherry
-
SpeciesSynthetic
- Promoter 8xGliBS-delta-crystallin minimal promoter
-
Tag
/ Fusion Protein
- ODC1 destabilizing element (C terminal on insert)
Cloning Information
- Cloning method Restriction Enzyme
- 5′ cloning site XhoI (not destroyed)
- 3′ cloning site EcoRI (not destroyed)
- 5′ sequencing primer pBluescript-SK
- 3′ sequencing primer unknown
- (Common Sequencing Primers)
Resource Information
-
A portion of this plasmid was derived from a plasmid made bymCherry from pRSET-mCherry (R. Tsien); 8xGliBS-delta-crystallin from 8xGliBS-Luciferase (H. Kondoh), Odc1 from d1EGFP (Clontech)
-
Article Citing this Plasmid
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
The amino acid sequence of the Odc1-derived destabilizing element is: SHGFPPAVAAQDDGTLPMSCAQESGMDRHPAACASARINV.
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
8xGliBS-IVS2-mCherry-NLS-Odc1-polyA-Tol2 was a gift from James Chen (Addgene plasmid # 84603 ; http://n2t.net/addgene:84603 ; RRID:Addgene_84603) -
For your References section:
In vivo imaging of Hedgehog pathway activation with a nuclear fluorescent reporter. Mich JK, Payumo AY, Rack PG, Chen JK. PLoS One. 2014 Jul 28;9(7):e103661. doi: 10.1371/journal.pone.0103661. eCollection 2014. PONE-D-14-13224 [pii] PubMed 25068273