We narrowed to 32,307 results for: IGH@;
-
Plasmid#15310DepositorInsertPRKACA (Prkaca Mouse)
ExpressionMammalianAvailable SinceJuly 6, 2007AvailabilityAcademic Institutions and Nonprofits only -
pREDusk-StrR-MCS
Plasmid#188972PurposeFor red light-repressed bacterial expression of gene of interest (StrR)DepositorTypeEmpty backboneExpressionBacterialAvailable SinceSept. 26, 2022AvailabilityAcademic Institutions and Nonprofits only -
YeNL_pRSETb
Plasmid#89520PurposeYellow color variant of bright luminescent protein for bacterial expressionDepositorInsertYeNL
TagsHis X 6ExpressionBacterialPromoterT7Available SinceMay 4, 2017AvailabilityAcademic Institutions and Nonprofits only -
pGDP3 arr
Plasmid#112890PurposeThis plasmid is part of the Minimal Antibiotic Resistance Platform (ARP) Kit (Addgene #1000000143). Low copy-number plasmid that constitutively expresses genes using the Pbla promoter.DepositorInsertarr
Tags6xHisExpressionBacterialPromoterPblaAvailable SinceDec. 10, 2018AvailabilityAcademic Institutions and Nonprofits only -
pGDP1 stat
Plasmid#112886PurposeThis plasmid is part of the Minimal Antibiotic Resistance Platform (ARP) Kit (Addgene #1000000143). Low copy-number plasmid that constitutively expresses genes using the Pbla promoter.DepositorInsertstat
Tags6xHisExpressionBacterialPromoterPblaAvailable SinceDec. 10, 2018AvailabilityAcademic Institutions and Nonprofits only -
pCbeta EV (PKA catalytic subunit Cbeta)
Plasmid#15311DepositorInsertPRKACB (Prkacb Mouse)
ExpressionMammalianAvailable SinceJuly 6, 2007AvailabilityAcademic Institutions and Nonprofits only -
pLenti-dSaCas9-KRAB-gRNA-TRE-blast
Plasmid#201151PurposeLentiviral expression of S. aureus dead Cas9 (dCas9/dSaCas9/SadCas9) fused to the KRAB domain as well as a gRNA targeting the tight TRE promoter and the blasticidin resistance gene.DepositorInsertsSadCas9-KRAB
gRNA-TRE
UseCRISPR and LentiviralTagsHAMutationgRNA sequence: ATCAGTGATAGAGAACGTATGAvailable SinceJuly 25, 2023AvailabilityAcademic Institutions and Nonprofits only -
pGL2B -938/+64
Plasmid#24943DepositorAvailable SinceAug. 18, 2010AvailabilityAcademic Institutions and Nonprofits only -
OeNL_pRSETb
Plasmid#89529PurposeOrange color variant of bright luminescent protein for bacterial expressionDepositorInsertOeNL
TagsHis X 6ExpressionBacterialPromoterT7Available SinceApril 19, 2017AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-neo-Strep_Flag_Nterm
Plasmid#102644PurposeEpitope tag n-terminus with SBP-Flag moietyDepositorTypeEmpty backboneTagsSBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPG…ExpressionMammalianAvailable SinceOct. 19, 2017AvailabilityAcademic Institutions and Nonprofits only