We narrowed to 19,105 results for: Comp;
-
Plasmid#19491DepositorAvailable SinceOct. 6, 2008AvailabilityAcademic Institutions and Nonprofits only
-
pENN239_CRISPRcharm_Kv1
Plasmid#220838PurposeCRISPRcharm Kv1 expression in mammalian cellsDepositorInsertCRISPRcharm Kv1
UseCRISPRTagsP2A-TagBFPExpressionMammalianMutationN/APromoterCAGAvailable SinceJune 25, 2024AvailabilityAcademic Institutions and Nonprofits only -
pSLQ2817 pPB: CAG-PYL1-VPR-IRES-Puro-WPRE-SV40PA PGK-ABI-tagBFP-SpdCas9
Plasmid#84239PurposeExpresses ABA-inducible VPR-Sp dCas9DepositorInsertsABI-tagBFP-Sp dCas9
PYL1-VPR
UseCRISPR and Synthetic Biology; PiggybacTags2xNLS (SV40), ABI, HA tag, IRES-Puro, PYL1, and t…ExpressionMammalianPromoterCAG and PGKAvailable SinceNov. 9, 2016AvailabilityAcademic Institutions and Nonprofits only -
Flag-V0A
Plasmid#210347PurposeExpresses ATP6V0A in mammalian cellsDepositorAvailable SinceJan. 2, 2024AvailabilityAcademic Institutions and Nonprofits only -
OPEN HLA-A*02:01-BirA
Plasmid#215569PurposeE. coli expression of BirA tagged HLA-A*02:01 containing a cysteine mutation for disulfide linkage to mutant beta-2 microglobulin.DepositorInsertOPEN HLA-A*02:01 (HLA-A Human)
TagsBirAExpressionBacterialMutationGlycine 120 to CysteinePromoterT7Available SinceMarch 27, 2024AvailabilityAcademic Institutions and Nonprofits only -
pDEST47-CYFIP1.GFP
Plasmid#109139PurposeGFP-tagged CYFIP1 expression constructDepositorAvailable SinceFeb. 7, 2019AvailabilityAcademic Institutions and Nonprofits only -
pcDNA -CLCN5-3xFlag
Plasmid#225507PurposeCLCN5 expression vectorDepositorAvailable SinceMay 14, 2025AvailabilityAcademic Institutions and Nonprofits only -
pAAV-pCALM1-SpCas9-miniU6-sgRNAShank3
Plasmid#213973PurposeAAV vector to express SpCas9 driven by pCALM1 promoter for targeting Shank3 locusDepositorInsertShank3 sgRNA
UseAAV and CRISPRAvailable SinceMay 15, 2024AvailabilityAcademic Institutions and Nonprofits only -
GFP-CHC17KDP
Plasmid#59799PurposeExpresses knockdown-proof human CHC17 tagged with GFP.DepositorInsertCHC17 (CLTC Human)
TagsGFPExpressionMammalianMutationSilent mutations in amino acids 61-65 to confer s…PromoterCMVAvailable SinceDec. 5, 2014AvailabilityAcademic Institutions and Nonprofits only -
pFB2B
Plasmid#195284PurposeBicistronic HSV-TK and Puromycin resistance for positive/negative selectionDepositorInsertHSV-TK 2A Puro
ExpressionMammalianPromoterPGKAvailable SinceJan. 26, 2023AvailabilityAcademic Institutions and Nonprofits only -
pNH605-CCAAT-YFP
Plasmid#172132PurposeFluorescent reporter for HAP complex activityDepositorInsert4xCCAAT-YFP
UseVector for genomic integration into the yeast gen…ExpressionYeastPromoterCYC1 core promotor with 4 tandem repeats of the H…Available SinceNov. 9, 2021AvailabilityAcademic Institutions and Nonprofits only -
MYC-hTRAK2
Plasmid#225142PurposeExpresses MYC-tagged human TRAK2DepositorAvailable SinceOct. 31, 2024AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pORTMAGE-4
Plasmid#72679PurposeExpresses Lambda Red recombinases and a dominant negative MutL allele all controlled by temperature sensitve cI857 repressor for high precision and efficiency MAGE experiments. Cam resistance marker.DepositorInsertmutL E32K
TagsnoneExpressionBacterialMutationE32K mutation conferring dominant mutator phenoty…Available SinceFeb. 18, 2016AvailabilityAcademic Institutions and Nonprofits only -
pSEMS-CV SUy-Halo7Tag
Plasmid#108933PurposeSelflabeling tag at ATP SynthaseDepositorInsertATP synthase F1 subunit gamma (ATP5F1C Human)
TagsHalo7 tagExpressionMammalianPromoterCMVAvailable SinceJune 25, 2018AvailabilityAcademic Institutions and Nonprofits only -
PtPuc3_diaCas9_sgRNA
Plasmid#109219PurposeEpisome based vector with CRISPR/Cas9_sgRNA module for genome editing in Phaeodactylum tricornutumDepositorInsertsLHCF2 promoter
diaCas9
LHCF1 terminator
U6 promoter
sgRNA
U6 3' region
UseCRISPR and Synthetic BiologyPromoterLHCF1 terminator, LHCF2 promoter, U6 3' regi…Available SinceJune 14, 2018AvailabilityAcademic Institutions and Nonprofits only -
DYRK1A/pTRE3G-FL-hXIST
Plasmid#149608PurposeExpress doxycycline-inducible full length of human XIST cDNADepositorAvailable SinceJuly 24, 2020AvailabilityAcademic Institutions and Nonprofits only -
pLV_hU6-sgRNA_hUbC-dCas9-ZIM3-KRAB-T2a-PuroR
Plasmid#172982Purposecontrol & cloning vector for CRISPRi expressing dead Cas9-ZIM3-KRAB fusionDepositorInsertcontrol sgRNA
UseCRISPR and LentiviralAvailable SinceOct. 11, 2023AvailabilityAcademic Institutions and Nonprofits only -
pCDH_CMV_TFAM_mKate2
Plasmid#167331PurposeExpresses mKate2 fused to full length TFAM in mammalian cellsDepositorAvailable SinceApril 14, 2021AvailabilityAcademic Institutions and Nonprofits only -
pNTI647 dCas9-Mxi1 TetR KanMX
Plasmid#139474PurposeIntegrates CRISPRi effector and tet-responsive regulatorDepositorInsertsdCas9-Mxi1
Tet Repressor
UseCRISPRTagsMxi1 and NLSExpressionYeastMutationD10A, H840APromoterpGPM1 and pTEF1Available SinceNov. 16, 2020AvailabilityAcademic Institutions and Nonprofits only