We narrowed to 16,486 results for: form
-
Plasmid#124929PurposeExpression of RGG domain from LAF-1 geneDepositorAvailable SinceMay 29, 2019AvailabilityAcademic Institutions and Nonprofits only
-
pClneoMyc human NDR1
Plasmid#37023DepositorAvailable SinceMay 23, 2012AvailabilityAcademic Institutions and Nonprofits only -
pMXs-IP GFP-Atg14
Plasmid#38264DepositorInsertautophagy related genes 14 (ATG14 Human)
UseRetroviralTagsEGFPExpressionMammalianPromoterLTRAvailable SinceAug. 17, 2012AvailabilityAcademic Institutions and Nonprofits only -
Affibody HER2:243.BirA*-pET301/NT-DEST
Plasmid#174692PurposePlasmid encoding for the bacterial expression of a bispecific coding for the anti-HER2 affibody ZHER2:342 fused to the mutated form of BirA enzyme, BirA*DepositorInsertAnti-HER2 affibody ZHER2:342 fused to mutated form of BirA, BirA*
TagsHIS tagExpressionBacterialMutationR118G mutation in BirAPromoterT7 promoterAvailable SinceJan. 7, 2022AvailabilityAcademic Institutions and Nonprofits only -
pQE60 R124K wgMDH
Plasmid#204258PurposeBacterial expression of R124K wgMDH with IPTG induction - Active site mutantInsertMDHG_CITLA
Tags6X HisExpressionBacterialMutationR124KAvailable SinceOct. 23, 2023AvailabilityAcademic Institutions and Nonprofits only -
pQE60 R124Q wgMDH
Plasmid#204259PurposeBacterial expression of R124Q wgMDH with IPTG induction - Active site mutantInsertMDHG_CITLA
Tags6X HisExpressionBacterialMutationR124QAvailable SinceOct. 23, 2023AvailabilityAcademic Institutions and Nonprofits only -
pQE60 R130E wgMDH
Plasmid#204267PurposeBacterial expression of R130E wgMDH with IPTG induction - Active site mutantInsertMDHG_CITLA
Tags6X HisExpressionBacterialMutationR130EAvailable SinceOct. 23, 2023AvailabilityAcademic Institutions and Nonprofits only -
pEGFP-C1-hUVRAG
Plasmid#24296DepositorAvailable SinceJune 24, 2010AvailabilityAcademic Institutions and Nonprofits only -
mCherry_EHMT1_full length
Plasmid#228810PurposeExpression of mouse EHMT1DepositorAvailable SinceMarch 10, 2025AvailabilityAcademic Institutions and Nonprofits only -
pCI-neo-HA-hAtg14
Plasmid#24294DepositorAvailable SinceSept. 15, 2010AvailabilityAcademic Institutions and Nonprofits only -
pJCC_076 AsCas12a R1226A
Plasmid#171669PurposeFor bacterial expression of AsCas12a R1226A (RuvC-inhibiting mutation) with an N-terminal His-MBP tagDepositorInsertAsCas12a R1226A
Tags10X His, TEV protease cleavage site, and maltose-…ExpressionBacterialMutationchanged arginine 1226 to alanineAvailable SinceJune 16, 2021AvailabilityAcademic Institutions and Nonprofits only -
pET21c(+)-EFG1mt
Plasmid#31076DepositorInsertMature form human mitochondrial elongation factor G isoform 1 (GFM1 Human)
TagsHisExpressionBacterialMutationIncludes the coding sequence for the mature form.…Available SinceSept. 29, 2011AvailabilityAcademic Institutions and Nonprofits only -
GB1-PRD(800-868)
Plasmid#141345PurposeCodon-optimized bacterial expression plasmid. Expresses GB1-His6-TEV-ALIX(800-868).DepositorInsertGB1His6-TEV-ALIX(800-868)
TagsGB1-His6-TEVExpressionBacterialAvailable SinceSept. 1, 2020AvailabilityAcademic Institutions and Nonprofits only -
pET21c(+)-mtPheRS
Plasmid#31080DepositorInsertMature form human mitochondrial phenylalanine-tRNA synthetase (FARS2 Human)
TagsHisExpressionBacterialMutationIncludes coding sequence for the mature form. Nt …PromoterT7Available SinceSept. 19, 2011AvailabilityAcademic Institutions and Nonprofits only -
pET28-MRPP1
Plasmid#67862Purposebacterial expression of TRMT10C, full coding sequence (mitoch. form) + N-term. His tag (thrombin site)DepositorInsertMRPP1 (TRMT10C Human)
TagsHisExpressionBacterialMutationmitoch. form (contains aa 40-403)PromoterT7Available SinceAug. 14, 2015AvailabilityAcademic Institutions and Nonprofits only -
pQE60 R196M wgMDH
Plasmid#204273PurposeBacterial expression of R196M wgMDH with IPTG induction - Active site mutantInsertMDHG_CITLA
Tags6X HisExpressionBacterialMutationR196MAvailable SinceOct. 23, 2023AvailabilityAcademic Institutions and Nonprofits only -
pQE60 D193E wgMDH
Plasmid#204269PurposeBacterial expression of D193E wgMDH with IPTG induction - Active site mutantInsertMDHG_CITLA
Tags6X HisExpressionBacterialMutationD193EAvailable SinceOct. 23, 2023AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-neo-Strep_Flag_Cterm
Plasmid#102645PurposeEpitope tag c-terminus with SBP-Flag moietyDepositorTypeEmpty backboneTagsSBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPG…ExpressionMammalianAvailable SinceOct. 19, 2017AvailabilityAcademic Institutions and Nonprofits only -
pClneoMyc human MOB1
Plasmid#37024DepositorAvailable SinceMay 23, 2012AvailabilityAcademic Institutions and Nonprofits only -
CBP TAZ1(340-439)
Plasmid#173760Purposebacterial expression of mouse CBP TAZ1 domainDepositorAvailable SinceFeb. 1, 2022AvailabilityAcademic Institutions and Nonprofits only