We narrowed to 8,399 results for: GAL
-
Plasmid#177070PurposeMoClo Level 1, position 2, transcriptional unit for transient expression of 1-deoxy-D-xylulose 5-phosphate synthase (CrDXS2) from Catharanthus roseus promoter regions contains 4x attB sites for recruitment fo gal4AD-phiC31DepositorInsert1-deoxy-D-xylulose 5-phosphate synthase (CrDXS2) from Catharanthus roseus
UseSynthetic BiologyAvailable SinceDec. 6, 2021AvailabilityAcademic Institutions and Nonprofits only -
pEPQD1CB0861
Plasmid#177078PurposeMoClo Level 1, position 6, transcriptional unit for transient expression of 7-deoxyloganetic acid glucosyl transferase (Cr7-DLGT) from Catharanthus roseus promoter regions contains 4x attB sites for recruitment fo gal4AD-phiC31DepositorInsert7-deoxyloganetic acid glucosyl transferase (Cr7-DLGT) from Catharanthus roseus
UseSynthetic BiologyAvailable SinceDec. 3, 2021AvailabilityAcademic Institutions and Nonprofits only -
pEPQD1CB0796
Plasmid#177074PurposeMoClo Level 1, position 4, transcriptional unit for transient expression of 8-hydroxygeraniol oxidoreductase (CrGOR) from Catharanthus roseus promoter regions contains 4x attB sites for recruitment fo gal4AD-phiC31DepositorInsert8-hydroxygeraniol oxidoreductase (CrGOR) from Catharanthus roseus
UseSynthetic BiologyAvailable SinceDec. 3, 2021AvailabilityAcademic Institutions and Nonprofits only -
-
CMYA5T/pACT2
Plasmid#97209PurposeCMYA5 (aa 4039 – 4069) Leu allele (4063) in a GAL4 AD vector, used for yeast-two hybridDepositorAvailable SinceAug. 21, 2017AvailabilityIndustry, Academic Institutions, and Nonprofits -
pcDNA5 FRT TO myc Separase delta 55
Plasmid#59824PurposeAllows the integration of myc Separase delta 55 in the genome and Tet-inducible expression.DepositorInsertSeparase (ESPL1 Human)
TagsMycExpressionMammalianMutationdelta 55Promoterhybrid human cytomegalovirus (CMV)/TetO2 promoterAvailable SinceFeb. 18, 2015AvailabilityAcademic Institutions and Nonprofits only -
pGEN25-Ub Hs
Plasmid#83232PurposepHis-par2-Ub HsDepositorAvailable SinceNov. 22, 2016AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pAAV-anti-GFP(LaG17) PAGER(TF)
Plasmid#229997PurposeExpresses anti-GFP PAGER(TF) (high reversibility) in mammalian cells; used with NanoLuc-Arrestin-TEVp (Addgene #125228) and UAS-Firefly Luciferase reporter (Addgene #104840)DepositorInsertIL2SP-Aro6-LaG17-TEVcs-ALFA-KORD(RAA)-LOV-TEVcs-Gal4
UseAAVExpressionMammalianMutationV360A/R361A on KORDPromoterCMVAvailable SinceJan. 6, 2025AvailabilityAcademic Institutions and Nonprofits only -
pGMβ1
Plasmid#216202PurposeChromosomal gene manipulation (gene insertion, conversion, deletion) of dairy used Lactobacillus bulgaricus, a difficult gene to manipulate, is now possible by conjugation using this pGMB1 plasmid.DepositorTypeEmpty backboneUseShuttle vector, conjugal plasmid, theta type rep…ExpressionBacterialPromoterlac promoter in pGEM-Teasy, Promoters in pAMbeta1…Available SinceJan. 21, 2025AvailabilityIndustry, Academic Institutions, and Nonprofits