pc3XB-ZF133
(Plasmid
#13183)
-
Depositing Lab
-
Sequence Information
Ordering
| Item | Catalog # | Description | Quantity | Price (USD) | |
|---|---|---|---|---|---|
| Plasmid | 13183 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $89 | |
Backbone
-
Vector backbonepc3XB
-
Backbone manufacturerModified Invitrogen pcDNA3
- Backbone size w/o insert (bp) 5400
-
Vector typeMammalian Expression
-
Selectable markersNeomycin (select with G418)
Growth in Bacteria
-
Bacterial Resistance(s)Ampicillin, 100 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)XL1 Blue
-
Copy numberHigh Copy
Gene/Insert
-
Gene/Insert nameZF133
-
Insert Size (bp)90
Cloning Information
- Cloning method Restriction Enzyme
- 5′ cloning site XbaI (not destroyed)
- 3′ cloning site BamHI (not destroyed)
- 5′ sequencing primer T7 (Common Sequencing Primers)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
Part of the Zinc Finger Consortium Modular Assembly Kit v1.0. Finger protein sequence: PGEKPYVCDVEGCTWKFARSDKLNRHKKRH. Target DNA sequence: GGG. This zinc finger is derived from the ToolGen module set. ToolGen ZF ID: 36. ToolGen ZF Name: RDKR .
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
pc3XB-ZF133 was a gift from Keith Joung (Addgene plasmid # 13183 ; http://n2t.net/addgene:13183 ; RRID:Addgene_13183) -
For your References section:
Standardized reagents and protocols for engineering zinc finger nucleases by modular assembly. Wright DA, Thibodeau-Beganny S, Sander JD, Winfrey RJ, Hirsh AS, Eichtinger M, Fu F, Porteus MH, Dobbs D, Voytas DF, Joung JK. Nat Protoc. 2006;1(3):1637-52. doi: 10.1038/nprot.2006.259 10.1038/nprot.2006.259 PubMed 17406455