We narrowed to 20,007 results for: LEA
-
Plasmid#22147DepositorAvailable sinceNov. 13, 2009AvailabilityAcademic Institutions and Nonprofits only
-
pLVX-EF1a-EGFP-Membrin-IRES-Puromycin
Plasmid#134865PurposeExpresses EGFP-tagged Golgi apparatus markerDepositorAvailable sinceMarch 3, 2020AvailabilityAcademic Institutions and Nonprofits only -
NES-EGFP-cPHx2
Plasmid#116854PurposePI(3,4)P2 biosensorDepositorInsertPLEKHA1 (PLEKHA1 Human)
TagsEGFP and X.leavis map2k1.L(32-44)ExpressionMammalianMutationamino acids 169-329 (tandem dimer)Available sinceOct. 11, 2018AvailabilityAcademic Institutions and Nonprofits only -
RINS1(mut)
Plasmid#107291PurposePlasmid for the expression of the inactive mutant of RINS1 sensorDepositorInsertRINS1(mut)
TagssfGFPExpressionMammalianMutationtwo Arg/Ser mutations at the beginning and in the…PromoterCMVAvailable sinceMay 1, 2018AvailabilityAcademic Institutions and Nonprofits only -
pOTTC414 - pAAV EF1a hPREP
Plasmid#59967PurposeAn AAV packaging vector that expresses hPREP under control of the EF1a promoter.DepositorAvailable sinceOct. 8, 2014AvailabilityAcademic Institutions and Nonprofits onlyCited by -
FLAG-Pol-II CC
Plasmid#35180DepositorPublicationInsertRPBI (POLR2A Human)
TagsFLAGExpressionMammalianMutationContains C-terminal domain repeats (1-22)X2PromoterCMVAvailable sinceMarch 30, 2012AvailabilityAcademic Institutions and Nonprofits only -
pEGFP-C1-PRKAA1ΔC
Plasmid#30306DepositorInsertAMP-activated Protein Kinase α1 ΔC (Prkaa1 Rat)
TagsGFPExpressionMammalianMutationdeleted amino acids Pro 526 to Gln 548Available sinceAug. 26, 2011AvailabilityAcademic Institutions and Nonprofits only -
pSBbi-Pur-dCas9-KRAB-MeCP2_hU6-SapI
Plasmid#196078Purpose(Empty Backbone) Constitutive CRISPRi vector conferring puromycin resistance, ready for insertion of gRNA targeting gene of interest using SapI restriction sites.DepositorInsertsdCas9-KRAB-MeCP2 repressor
hU6 promoter and gRNA scaffold
ExpressionMammalianMutationCatalytically dead mutant of the Cas9 endonucleas…Available sinceMarch 30, 2023AvailabilityAcademic Institutions and Nonprofits onlyCited by -
FLT1-KDR
Plasmid#86034Purposechimera of human VEGFR1 extracellular domain with the TMD fused to the intracellular domain of VEGFR2DepositorAvailable sinceApril 6, 2017AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable sinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pAS_4xMx PylT_GFP 150TAG
Plasmid#140016PurposePlasmid with 4xMxPylT cassette and amber suppression reporter sfGFP 150 TAG stop; for transient transfection or stable piggyBac-mediated integrationDepositorInsertsfGFP
ExpressionMammalianMutation150TAG, K46E (Please see depositor comments below)PromoterEF1Available sinceMay 20, 2020AvailabilityAcademic Institutions and Nonprofits only -
pEGFP-ninein C-ter
Plasmid#73523PurposeEncodes the C-terminus of mouse ninein (residues 1874-2113) with an EGFP tag at its N-terminusDepositorInsertninein C-ter (residues 1874-2113) (Nin Mouse)
TagsEGFP tagExpressionMammalianPromoterCMVAvailable sinceApril 29, 2016AvailabilityAcademic Institutions and Nonprofits only -
3xFNLDD/pMXs-puro
Plasmid#49536PurposeExpresses 3xFNLDD in mammalian cellsDepositorInsert3xFNLDD
UseRetroviralTags3xFLAG tag and NLS (nuclear localization signal)ExpressionMammalianPromoterLTRAvailable sinceDec. 18, 2013AvailabilityAcademic Institutions and Nonprofits onlyCited by -
hFLT1 delta CTD
Plasmid#86036Purposehuman VEGFR1 with deletion of the entire intracellular domainDepositorInserthuman Flt1 delta CTD (FLT1 Human)
TagsFLAG and HAExpressionMammalianMutationdeta CTDPromoterCMVAvailable sinceApril 6, 2017AvailabilityAcademic Institutions and Nonprofits only -
pMT-MCS-NLS-BirA-2A-mCherry_Ras
Plasmid#80059PurposeMCS for cloning promoter to drive HA-tagged biotin ligase (BirA) with NLS, a Thosea asigna virus peptide (2A), and membrane-tethered mCherry protein (membCherry); flanked by Tol2 sequencesDepositorInsertBiotin ligase (BirA) with nuclear localization signal (NLS), a Thosea asigna virus peptide (2A), and mCherry protein
UseZebrafish biotaggingTags3x HAExpressionBacterialAvailable sinceOct. 11, 2016AvailabilityAcademic Institutions and Nonprofits only -
pMT-ubb-NLS-BirA-2a-mCherry
Plasmid#79886PurposeUbiquitin promoter driving HA-tagged biotin ligase (BirA) with nuclear localization signal (NLS), a Thosea asigna virus peptide (2A), and mCherry protein; flanked by Tol2 sequencesDepositorInsertBiotin ligase (BirA) with nuclear localization signal (NLS), a Thosea asigna virus peptide (2A), and mCherry protein
Tags3x HAExpressionBacterialPromoterUbiquitinAvailable sinceOct. 11, 2016AvailabilityAcademic Institutions and Nonprofits only -
HisMBP CFlm25
Plasmid#78458PurposeInducible expression in E. coliDepositorInsertHuman Cleavage Factor lm 25 kDa subunit (NUDT21 Human)
TagsHis and MBPExpressionBacterialPromotertacAvailable sinceJuly 22, 2016AvailabilityAcademic Institutions and Nonprofits only -
TALEN-CCR5R18-CtermQ7
Plasmid#51443PurposeExpresses TALEN targeting right CCR5A site (R18) with Q7 C-terminal domainDepositorInsertTALEN CCR5 Right (R18) Q7 C-term
UseTALENTags3xFLAG and Fok1 KK variantExpressionMammalianMutationK777Q, K778Q, K788Q, R789Q, R792Q, R793Q and R801QPromoterCMVAvailable sinceApril 1, 2014AvailabilityAcademic Institutions and Nonprofits only -
Human 3' HP1a AID GFP PuroR
Plasmid#127906PurposeHDR (donor) Plasmid for Inserting AID-GFP-2A-Puro into the 3' end of the Human HP1a GeneDepositorInsertHP1 (CBX5 Human, Mustard Weed)
UseDonor plasmidTagsGFP, AID, PuroRMutationInserting GFP AID 2A Puro into mouse 3' Hp1aAvailable sinceSept. 12, 2019AvailabilityAcademic Institutions and Nonprofits onlyCited by -
pCEP4-HA-CCR5
Plasmid#98950PurposeMammalian expression plasmid for N-terminal HA-tagged human CCR5DepositorInsertCCR5 (CCR5 Human)
TagsHA (YPYDVPDYA) epitope tag and Signal/leader sequ…ExpressionMammalianMutationFull-length, wildtypePromoterCMVAvailable sinceApril 24, 2018AvailabilityAcademic Institutions and Nonprofits onlyCited by