We narrowed to 81,469 results for: MYC;
-
Plasmid#242956PurposeMammalian expression plasmid for Anti-c-Myc [9E10] fused to mouse kappa light chain constant region; to be used with pAG mIgG2a Anti-c-Myc [9E10] heavy chain (Plasmid 242955) to make the antibody.DepositorInsertAnti-c-Myc [9E10] light chain variable region fused to mouse kappa light chain constant region
ExpressionMammalianPromoterCMVAvailable SinceNov. 6, 2025AvailabilityIndustry, Academic Institutions, and Nonprofits -
pT3-EF1A-MYC-IRES-lucOS
Plasmid#129776PurposeTransposon based vector that expresses human MYC followed by IRES and firefly luciferase and the antigens SIYRYYGL (SIY), SIINFEKL (SIN, OVA257-264), and OVA323-339DepositorInserthuman MYC (MYC Human)
TagsOS: SIYRYYGL (SIY), SIINFEKL (SIN, OVA257-264), a…ExpressionMammalianPromoterEF1AAvailable SinceFeb. 13, 2020AvailabilityAcademic Institutions and Nonprofits only -
pFA6a-TurboID-3MYC-kanMX6 (pFB1420)
Plasmid#126049PurposeFor C-terminal tagging with TurboID in yeast including geneticin-resistant markerDepositorInsertTurboID
UsePcr-based c-terminal taggingAvailable SinceMay 21, 2019AvailabilityAcademic Institutions and Nonprofits only -
pFA6a-TurboID-3MYC-natMX6 (pFB1434)
Plasmid#126050PurposeFor C-terminal tagging with TurboID in yeast including nourseothricin-resistant markerDepositorInsertTurboID
UsePcr-based c-terminal taggingAvailable SinceMay 21, 2019AvailabilityAcademic Institutions and Nonprofits only -
pCDNA3.1-HsPcdh21-Myc-Flag-His
Plasmid#210818PurposeMammalian overexpression vector for C-terminally Myc and Flag and His tagged human Pchd21 (WT)DepositorAvailable SinceJuly 22, 2024AvailabilityAcademic Institutions and Nonprofits only -
pGEX-4T-3-GST-Tev-Af1521-myc
Plasmid#196239PurposeN-terminal GST fusion of Af1521(WT) with a TEV protease site located between the GST tag and Af1521 and a myc tag on the C terminusDepositorInsertN-terminal GST fusion of Af1521(WT) with a TEV protease site between GST and Af1521 encoding a C-terminal myc tag
TagsGST tag and myc tagExpressionBacterialAvailable SinceAug. 8, 2025AvailabilityAcademic Institutions and Nonprofits only -
pcDNA4-RI1-332-MYC-His6
Plasmid#185351PurposeMammalian expression of Ribophorin IDepositorAvailable SinceFeb. 14, 2023AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-myc-his-BACH1 K52R
Plasmid#17643DepositorInsertBACH1 (BRIP1 Human)
TagsHis and MycExpressionMammalianMutationThe lysine residue at position 52 was changed to …Available SinceApril 4, 2008AvailabilityAcademic Institutions and Nonprofits only -
pGL3-U6-XsgRNA-ccdB-EF1a-Puromycin
Plasmid#115519PurposeTo construct multiple sgRNA expression vector for CRISPRDepositorInsertccdB-sgRNA scaffold
UseCRISPRAvailable SinceOct. 29, 2018AvailabilityAcademic Institutions and Nonprofits only -
pCI-Puro_hCOL4A2-Myc-His-WPRE
Plasmid#198080PurposeExpress hCOL4A2 in mammalian cellsDepositorInsertCOL4A2 (COL4A2 Human)
TagsTEV-Myc-HisExpressionMammalianPromoterCMV, beta-globin/IgG chimeric intronAvailable SinceApril 13, 2023AvailabilityAcademic Institutions and Nonprofits only -
pBABE-hygro-2xMyc-Rac1-P29S
Plasmid#128581PurposeFor mammalian cell expression of P29S mutant murine RAC1 carrying 2x Myc epitope tag sequences at the N-terminus.DepositorInsertRac1 (Rac1 Mouse)
UseRetroviralTags2xMyc epitopeExpressionMammalianMutationChanged Proline29 to Serine.Available SinceAug. 12, 2019AvailabilityAcademic Institutions and Nonprofits only -
PCMV-intron myc Rab1a S25N
Plasmid#46777Purposeexpression of S25N Rab1a in mammalian cellsDepositorInsertRab1a S25N mutant (RAB1A Human)
TagsmycExpressionMammalianMutationS25N (dominant negative)PromoterCMVAvailable SinceNov. 14, 2013AvailabilityAcademic Institutions and Nonprofits only -
pInducer-myc-ERK2-R67S/S153D
Plasmid#213597PurposeDoxycycline inducible expression of myc-tagged ERK2-R67S/S153D cDNA in mammilian cellsDepositorAvailable SinceAug. 23, 2024AvailabilityAcademic Institutions and Nonprofits only -
pBABE-hygro-2xMyc-Rac1-Q61L
Plasmid#128582PurposeFor mammalian cell expression of Q61L mutant murine RAC1 carrying 2x Myc epitope tag sequences at the N-terminus.DepositorInsertRac1 (Rac1 Mouse)
UseRetroviralTags2xMyc epitopeExpressionMammalianMutationChanged Glutamine61 to Leucine.Available SinceAug. 13, 2019AvailabilityAcademic Institutions and Nonprofits only -
pLVH-EF1a-GFP-P2A-MYC
Plasmid#130695PurposeLentiviral plasmids encoding human MYC with co-expressoin of GFP mediated by P2A.DepositorInserthuman MYC (MYC Human)
UseLentiviralAvailable SinceAug. 22, 2019AvailabilityAcademic Institutions and Nonprofits only -
pUSE-Src-YF-UniRapR-mCerulean-myc
Plasmid#45381DepositorInsertSrc-YF-UniRapR-mCerulean-myc
TagsMyc, Myr, and mCeruleanExpressionMammalianMutationchanged mSrc Tyrosine 529 to PhenylalaninePromoterCMVAvailable SinceNov. 7, 2013AvailabilityAcademic Institutions and Nonprofits only -
pBABE puro mouse IRS-1 myc
Plasmid#11374DepositorAvailable SinceApril 20, 2006AvailabilityAcademic Institutions and Nonprofits only -
NLS-Laconic/pCMV-myc-nuc
Plasmid#46307Purposea nuclear-targeted, genetically-encoded sensor for lactateDepositorInsertNLS-Laconic
UseLactate biosensorExpressionMammalianPromoterCMVAvailable SinceAug. 2, 2013AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pCAG-Myc-GRM1-IRES-CyRFP1
Plasmid#195355PurposemGluR1-IRES-cyRFP1 under the control of the pCAG promoterDepositorInsertGRM1-IRES-CyRFP1
ExpressionMammalianPromoterpCAGAvailable SinceMarch 1, 2023AvailabilityAcademic Institutions and Nonprofits only