We narrowed to 5,294 results for: codon optimized
-
Plasmid#217428PurposeLentiviral overexpression of human DHFRDepositorInsertDHFR (DHFR Human)
UseLentiviralTags3xFLAGExpressionMammalianMutationInsert sequence is a codon-optimized gBLOCK (IDT)PromoterCMVAvailable SinceJan. 31, 2025AvailabilityAcademic Institutions and Nonprofits only -
JG1211: CAG-human dLbCpf1(D832A)-NLS-3xHA-VPR
Plasmid#104567PurposeMammalian expression vector for catalytically inactive Cpf1 from Lachnospiraceae bacterium (dLbCpf1) fused to VPR activatorDepositorInserthuman codon optimized ‘dead’ Cpf1 fused to HSV VPR activation domain
UseCRISPRTagsNLS-3xHA-VPRExpressionMammalianMutationD832APromoterCAGAvailable SinceJan. 17, 2018AvailabilityAcademic Institutions and Nonprofits only -
pGES201
Plasmid#190197PurposeFor CRISPR-Cas9 mediated gene editing in soybean, soybean elongation factor 1A promoter (pM4)-Cas9, GmU6-sgRNA, Basta selectionDepositorInsertspCas9
UseCRISPRTags3xFlagExpressionPlantMutationplant-codon optimizedPromoterGlycine max elongation factor 1A(pM4)Available SinceSept. 14, 2022AvailabilityAcademic Institutions and Nonprofits only -
pACYC-T7-SpCas9-T7-EGFP_gRNA1-T7term (BPK848)
Plasmid#181745Purposedual T7 promoter vector for bacterial expression of SpCas9 with a c-terminal NLS and 3xFLAG tag, along with an SpCas9 sgRNA targeting EGFP site 1DepositorInserthuman/zebrafish codon optimized SpCas9
UseIn vitro transcription; t7 promoterTagsNLS(SV40)-3xFLAGExpressionBacterialPromoterT7Available SinceFeb. 16, 2022AvailabilityAcademic Institutions and Nonprofits only -
pSH-EFIRES-P-AtAFB2-mCherry-weak NLS
Plasmid#129717PurposeAAVS1 safe harbor targeting vector expressing AtAFB2-mCherry-weak NLSDepositorInsertAFB2 (AFB2 Mustard Weed)
UseCRISPR and TALEN; Human safe harbor locus (a avs1…TagsmCherry-weak NLSExpressionMammalianMutationcodon optimizedPromoterEF1aAvailable SinceSept. 25, 2019AvailabilityAcademic Institutions and Nonprofits only -
SpCas9-NRCH-ABE8e(V106W)
Plasmid#198556PurposeExpresses human codon-optimized SpCas9-NRCH-ABE8e(V106W) and blasticidin resistance: EFS promoter-SpCas9-NRCH-ABE8e(V106W)-NLS-FLAG-P2A-BSDDepositorInsertSpCas9-NRCH-ABE8e(V106W)
UseCRISPR and LentiviralTagsBSD, FLAG, and NLSExpressionMammalianPromoterEFSAvailable SinceNov. 5, 2024AvailabilityAcademic Institutions and Nonprofits only -
pMV306G13+FFlucRT
Plasmid#49997PurposeIntegrating vector with an improved Red-shifted Thermostable Firefly LuciferaseDepositorInsertG13 promoter + Firefly luciferase Red Thermostable
UseMycobacteria integrating vectorExpressionBacterialMutationCodon optimized for Mycobacterium tuberculosis wi…PromoterG13 from M. marinumAvailable SinceMay 21, 2014AvailabilityAcademic Institutions and Nonprofits only -
pEN114 - pCAGGS-Tir1-V5-BpA-Frt-PGK-EM7-PuroR-bpA-Frt-Rosa26
Plasmid#92143PurposeTargeting vector to introduce an osTir1 expressing cassette at the mouse Rosa26 locus using Puromycin selection. Auxin-inducible degron system.DepositorInsertosTir1
UseMouse TargetingTagsV5 tagExpressionMammalianAvailable SinceJune 26, 2017AvailabilityAcademic Institutions and Nonprofits only -
pSEVA251_ Ptrc.x.tetO2::D-HicDH
Plasmid#185456PurposeCDS of D-HicDH codon optimized for expression in Synechocystis sp. PCC 6803 under the control of the synthetic promoter Ptrc.x.tetO2 and the RBS BBa_B0030 in pSEVA251 plasmid.DepositorInsertD-HicDH from Lactobacillus paracasei DSM 20008
ExpressionBacterialPromoterPtrc.x.tetO2Available SinceJuly 27, 2022AvailabilityAcademic Institutions and Nonprofits only -
pAAV2-CAG-3xNLS-mScarlet
Plasmid#191098PurposeTo express a bright monomeric red FP to label eucaryotic cell nuclei. To be used in tissue clearing methods and other fluorescent microscopy methodsDepositorInsert3xNLS-mScarlet
UseAAV and Synthetic BiologyTagsThree repeats of the nuclear localizzation seque…ExpressionMammalianMutationOptimized to human codon usagePromoterCMV enhancer and CAGAvailable SinceDec. 16, 2022AvailabilityAcademic Institutions and Nonprofits only -
PD2529 human beta1 full
Plasmid#221401PurposeMammalian expression of human integrin beta1 full-lengthDepositorInsertintegrin beta1 full-length (ITGB1 Human)
TagsCD33 secretion peptide (MPLLLLLPLLWAGALA) and HA …ExpressionMammalianMutationcodon-optimized mature sequenceAvailable SinceJuly 15, 2024AvailabilityAcademic Institutions and Nonprofits only -
pKb-TnpB1
Plasmid#215333PurposeISDra2 expression driven by PolII promoter ; 20 bp guide RNA can be cloned in BsaI siteDepositorInsertRice codon optimized ISDra2 TnpB
TagsNot applicableExpressionPlantPromoterRice ubiquitin promoter for TnpB and OsU3 promote…Available SinceSept. 24, 2024AvailabilityAcademic Institutions and Nonprofits only -
H513 px330.sgActin.UTR.2
Plasmid#138176PurposeCRISPR SONIC: Encodes codon-optimized SpCas9 and gRNA for targeting 3' UTR of β-actin.DepositorAvailable SinceMarch 18, 2020AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pET28-SpRY-NLS-6xHis (gbr2101)
Plasmid#181743Purposebacterial expression plasmid for SpRY with an n-terminal MKIEE MBP tag, and c-terminal bi-partite NLS and 6x-His tagDepositorInsertbacterial codon optimized SpRY
UseIn vitro transcription; t7 promoterTagsBPNLS(SV40)-6xHis and MKIEE MBP tagExpressionBacterialMutationSpRY=A61R/L1111R/D1135L/S1136W/G1218K/E1219Q/N131…PromoterT7Available SinceFeb. 16, 2022AvailabilityAcademic Institutions and Nonprofits only -
FUW-crRNA1and2-U6_TRE-dLbCpf1-NLS-hCTCF_WT-HA-P2A-tagBFP
Plasmid#194885PurposeDox-inducible all-in-one lentiviral construct to express dCpf1-CTCF-WT and crRNA-1 and -2 targeting the human MECP2 locus.DepositorInsertsdLbCpf1-NLS-hCTCF_WT
U6-crRNA1and2
UseLentiviralTagsHAMutationHuman codon optimized catalytically inactive LbCp…PromoterTRE and U6Available SinceJan. 25, 2023AvailabilityAcademic Institutions and Nonprofits only -
pET42b-ABE7.10
Plasmid#120398PurposeExpresses ABE7.10-NLS with an N-terminal His Tag (His6) for bacterial expressionDepositorInsertABE7.10
TagsHisExpressionBacterialMutationMammalian codon-optimizedPromoterT7Available SinceApril 24, 2019AvailabilityAcademic Institutions and Nonprofits only -
pAAV-CAG-H2BmGreenLantern
Plasmid#177332PurposeTo express a bright monomeric green FP to label eucaryotic cell nuclei. To be used in clearing and other fluorescent microscope methods.DepositorInsertH2B (Hist1h2bq Rat)
UseAAVTagsmGreenLanternExpressionMammalianMutationThis fusion protein was optimized to the Human co…PromoterCAGAvailable SinceFeb. 4, 2022AvailabilityAcademic Institutions and Nonprofits only -
mEGFP-PI35P2
Plasmid#92419PurposeFluorescent reporter for phosphatidylinositol (3,5)-bisphosphate (PI(3,5)P2). Mouse MCOLN1 residues 1–68 fused to eGFP.DepositorInsertMCOLN1 (Mcoln1 Mouse)
TagseGFPExpressionMammalianMutationSynthetic gene, codon optimized for human.PromoterCMVAvailable SinceJuly 12, 2017AvailabilityAcademic Institutions and Nonprofits only -
pKb-TnpB2
Plasmid#215334PurposeISDra2 expression driven by PolII promoter ; 20 bp guide RNA can be cloned in BsaI siteDepositorInsertRice codon optimized ISDra2 TnpB
TagsNot applicableExpressionPlantPromoterRice ubiquitin promoter for TnpB and maize ubiqui…Available SinceOct. 1, 2024AvailabilityAcademic Institutions and Nonprofits only