We narrowed to 27,366 results for: c-myc
-
Plasmid#101153PurposegRNA with 14 MCP binding siteDepositorInsertMUC4 (MUC4 Human)
UseCRISPR and LentiviralAvailable sinceNov. 9, 2017AvailabilityAcademic Institutions and Nonprofits onlyCited by -
stabilized HP35 tension sensor module
Plasmid#101251PurposeExpresses the stabilized HP35-based tension sensor module. The biosensor allows force measurements at 9-11 pN.DepositorInsertYPet(short)-HP35st-mCherry
UseRetroviralTagsHis-tag and cysteineExpressionMammalianPromoterCMVAvailable sinceNov. 2, 2017AvailabilityAcademic Institutions and Nonprofits onlyCited by -
SQ171fg/pCSacB
Plasmid#69344PurposeSQ171 fast growing strain supported by pCSacB plasmidDepositorInsertpCSacB
Available sinceOct. 25, 2017AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-neo-Strep_Flag_Cterm
Plasmid#102645PurposeEpitope tag c-terminus with SBP-Flag moietyDepositorTypeEmpty backboneTagsSBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPG…ExpressionMammalianAvailable sinceOct. 19, 2017AvailabilityAcademic Institutions and Nonprofits onlyCited by -
p7052 pHAGE-P-CMVt-N-HA-GAW-AURKB
Plasmid#100142PurposeExpreses AURKBDepositorAvailable sinceOct. 3, 2017AvailabilityAcademic Institutions and Nonprofits onlyCited by -
CIB-VP64 (B1016)
Plasmid#92037PurposeExpresses CIB1 (Full-length, with endogenous NLS) fused to VP64 activation domain (4xVP16 inserts)DepositorHas service50 µg Transfection-Ready DNA and 100 µg Transfection-Ready DNAInsertCIB1-VP64 (CIB1 Mustard Weed)
TagsFusion of plant CIB1 with VP64 activation domain.…ExpressionMammalianPromoterCMVAvailable sinceJuly 25, 2017AvailabilityAcademic Institutions and Nonprofits onlyCited by -
CRY-Gal∆DD (B1013)
Plasmid#92035PurposeExpresses CRY2 (full-length, with endogenous NLS) fused to Gal4 (aa1-65 of Gal4BD), downstream of mCherry-IRESDepositorHas service50 µg Transfection-Ready DNA and 100 µg Transfection-Ready DNAInsertCRY2 (CRY2 Mustard Weed)
ExpressionMammalianMutationFusion of plant CRY2 to Gal4 binding domain (AA1-…Available sinceJuly 25, 2017AvailabilityAcademic Institutions and Nonprofits onlyCited by -
pDONR223_POU2F2_WT
Plasmid#81873PurposeGateway Donor vector containing POU2F2 , part of the Target Accelerator Plasmid Collection.DepositorAvailable sinceApril 24, 2017AvailabilityAcademic Institutions and Nonprofits only -
pDONR223_XPO1_WT
Plasmid#81812PurposeGateway Donor vector containing XPO1 , part of the Target Accelerator Plasmid Collection.DepositorAvailable sinceApril 24, 2017AvailabilityAcademic Institutions and Nonprofits only -
pDONR223_TNF_WT
Plasmid#81824PurposeGateway Donor vector containing TNF , part of the Target Accelerator Plasmid Collection.DepositorAvailable sinceApril 24, 2017AvailabilityAcademic Institutions and Nonprofits onlyCited by -
pDONR223_PTEN_WT
Plasmid#81737PurposeGateway Donor vector containing PTEN , part of the Target Accelerator Plasmid Collection.DepositorAvailable sinceApril 24, 2017AvailabilityAcademic Institutions and Nonprofits only -
pDONR223_SOCS3_WT
Plasmid#82245PurposeGateway Donor vector containing SOCS3 , part of the Target Accelerator Plasmid Collection.DepositorAvailable sinceApril 24, 2017AvailabilityAcademic Institutions and Nonprofits only -
pDONR223_SMAD4_WT
Plasmid#82216PurposeGateway Donor vector containing SMAD4 , part of the Target Accelerator Plasmid Collection.DepositorAvailable sinceApril 24, 2017AvailabilityAcademic Institutions and Nonprofits onlyCited by -
pDONR223_BAX_WT
Plasmid#82191PurposeGateway Donor vector containing BAX , part of the Target Accelerator Plasmid Collection.DepositorAvailable sinceApril 24, 2017AvailabilityAcademic Institutions and Nonprofits only -
pDONR223_BTK_WT
Plasmid#82197PurposeGateway Donor vector containing BTK , part of the Target Accelerator Plasmid Collection.DepositorAvailable sinceApril 24, 2017AvailabilityAcademic Institutions and Nonprofits only -
pDONR223_DVL1_WT
Plasmid#82110PurposeGateway Donor vector containing DVL1 , part of the Target Accelerator Plasmid Collection.DepositorAvailable sinceApril 24, 2017AvailabilityAcademic Institutions and Nonprofits only -
N1-moxDendra2
Plasmid#89792PurposeC-terminal fusion to moxDendra2DepositorTypeEmpty backboneTagsmoxDendra2ExpressionMammalianPromoterCMVAvailable sinceApril 24, 2017AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3 tdTomato LIC cloning vector (6F)
Plasmid#86963PurposeEmpty LIC vector; adds a tdTomato gene to the C-terminus of your protein of interest.DepositorTypeEmpty backboneTagstdTomatoExpressionMammalianPromoterCMVAvailable sinceMarch 28, 2017AvailabilityAcademic Institutions and Nonprofits only -
CMV ArcLightCo (Q239)-T2A-nls-mCherry
Plasmid#85806PurposeGenetically encoded voltage sensor ArcLight- codon optimizedDepositorHas service50 µg Transfection-Ready DNA and 100 µg Transfection-Ready DNAInsertArcLightCo-Q239
TagsmCherryExpressionMammalianMutationCi-VSP contains R217Q mutation; super ecliptic pH…PromoterCMVAvailable sinceJan. 30, 2017AvailabilityAcademic Institutions and Nonprofits only -
pUC57-white[coffee]
Plasmid#84006PurposeDonor HR template carrying a 2,080 bp fragment of the Drosophila melanogaster white[coffee] allele and silent mutations conferring resistance to white sgRNAs-1, -2, -3, and -4DepositorInsertA 2,080 bp fragment of the white[coffee] allele (w Fly)
UseUnspecifiedMutationA GC-to-AA mutation that creates a G589E missense…Available sinceNov. 8, 2016AvailabilityAcademic Institutions and Nonprofits onlyCited by