We narrowed to 44,723 results for: Ina
-
Plasmid#21910DepositorInsertHuman Soluble Fms-like Tyrosine Kinase 3 Ligand (FLT3LG Human)
UseAdenoviralAvailable SinceOct. 21, 2009AvailabilityAcademic Institutions and Nonprofits only -
pTSlb-R756K
Plasmid#60731PurposeExpresses both fragments of T7 RNAP split at position 179. The N-terminal fragment is driven by PLac while the C-terminal fragment is driven by PBAD. C-terminal fragment has the point mutations R756SDepositorInsertsResidues 1-179 of split T7 RNAP
Residues 180-880 of split T7 RNAP
UseSynthetic BiologyExpressionBacterialMutationResidues 1-180 of split T7 RNAP and Residues 180-…Available SinceNov. 4, 2014AvailabilityAcademic Institutions and Nonprofits only -
pMSCV mKeima-LC3
Plasmid#189006PurposeFluorescent reporter for autophagyDepositorInsertmKeima, LC3 (Map1lc3b Rat)
UseRetroviralAvailable SinceSept. 8, 2022AvailabilityAcademic Institutions and Nonprofits only -
pGEX6P1-HA-MEK1
Plasmid#53159PurposeExpresses GST-HA tagged human MEK1 from bacterial expression vectorDepositorAvailable SinceJune 12, 2014AvailabilityAcademic Institutions and Nonprofits only -
LentiV_Neo_SIK3_CR_K95M
Plasmid#108106PurposeLentiviral expression plasmid of human SIK3 cDNA (CRISPR-resistant silent mutation & kinase-dead mutation) with neomycin resistance geneDepositorInsertSIK3 (SIK3 Human)
UseCRISPR and LentiviralExpressionMammalianMutationchange guanine 501 to cytosine (silent mutation),…PromoterEFS promoterAvailable SinceApril 5, 2018AvailabilityAcademic Institutions and Nonprofits only -
pSS2.1-Cas9-HH-gRNADhps-HDV
Plasmid#241015PurposeCas9 expression cassette encoding a guide RNA targeting the Dhps locus, flanked by a hammerhead (HH) ribozyme at the 5′ end and a hepatitis delta virus (HDV) ribozyme at the 3′ endDepositorInsertsCas9-Hammerhead (HH) Ribozyme-gRNA(Dhps)-Hepatitis Delta Virus (HDV) Ribozyme
blasticidin-S deaminase
ExpressionYeastAvailable SinceNov. 12, 2025AvailabilityAcademic Institutions and Nonprofits only -
FASTHDR-Cterm-HaloTag-Puromycin
Plasmid#167208PurposePlasmid to clone recombination arms to create homologous recombination donor vector for C-terminal gene tagging with HaloTag and selection with PuromycinDepositorTypeEmpty backboneUseCRISPRTagsHaloTagExpressionMammalianAvailable SinceDec. 8, 2021AvailabilityAcademic Institutions and Nonprofits only -
FASTHDR-Cterm-mRuby3-Zeo
Plasmid#167206PurposePlasmid to clone recombination arms to create homologous recombination donor vector for C-terminal gene tagging with mRuby3 and selection with ZeocinDepositorTypeEmpty backboneUseCRISPRTagsmRuby3ExpressionMammalianAvailable SinceDec. 8, 2021AvailabilityAcademic Institutions and Nonprofits only -
pHLmMBP-10
Plasmid#72348PurposeMammalian expression of secreted N-terminally 8His-tagged mMBP TEV cleavage site-linked fusion proteins with C-terminal 6His-tag/Strep-tag II/HA-tagDepositorTypeEmpty backboneTags6His-tag, 8His-tag, HA-tag, Strep-tag II, and mMB…ExpressionMammalianPromoterCMV enhancer + chicken beta-actin promoterAvailable SinceFeb. 17, 2016AvailabilityAcademic Institutions and Nonprofits only -
pcDNA4c/His-Xpress-HA-hBIG1(WT)
Plasmid#79431PurposeExpresses N-terminally His6, Xpress and HA-tagged BIG1(WT) in mammalian cellsDepositorAvailable SinceJune 2, 2025AvailabilityAcademic Institutions and Nonprofits only -
AID-mTagBFP2-loxP_myo2_neoR-loxP
Plasmid#194055PurposeDual-selection cassette plasmid for knocking-in AID-mTagBFP2 into the C. elegans genomeDepositorAvailable SinceJan. 18, 2023AvailabilityAcademic Institutions and Nonprofits only -
pTwist-SFFV-NFE2L18ND-Puro
Plasmid#181918PurposeLentiviral plasmid that directs the expression of mutant NFE2L1/Nrf1 where 8 putative N-glycosites are mutated from asparagine to aspartic acid in mammalian cells.DepositorInsertNFE2L1 (NFE2L1 Human)
UseLentiviralTagsFLAG and HAExpressionMammalianMutation8 putative N-glycoyslation sites converted from a…PromoterSFFVAvailable SinceApril 6, 2022AvailabilityAcademic Institutions and Nonprofits only -
pAB46 (CK2beta)
Plasmid#27085DepositorAvailable SinceMay 17, 2012AvailabilityAcademic Institutions and Nonprofits only -
pIVT_goldDn29-dCas9-P2A-GFP
Plasmid#247167PurposeIn vitro transcription of human codon optimized fusion of goldDn29-dCas9-P2A-GFPDepositorInsertgoldDn29-dCas9-P2A-GFP
UseIn vitro transcriptionTagsSV40 NLSMutationM6I/E70G/A224P/G227V/Q332K/N341K/L393P/D503NPromotermutated T7Available SinceNov. 12, 2025AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pMpGWB337
Plasmid#68061PurposeGateway-based vector for Marchantia polymorpha to express a floxed gene, with an expression cassette for Cre-glucocorticoid receptor fusion protein under the control of heat-inducible promoterDepositorTypeEmpty backboneUseCre/LoxExpressionPlantPromoterMpEF1alpha promoterAvailable SinceSept. 18, 2015AvailabilityAcademic Institutions and Nonprofits only -
pFB1.HMBP.PrS.PHF19
Plasmid#125168PurposeExpresses human PHF19 in insect cells, , under a C3-cleavable (PreScission Protease) N-terminal hexahistidine-MBP tag.DepositorAvailable SinceApril 27, 2020AvailabilityAcademic Institutions and Nonprofits only -
W118-1_hTGM2-Flag
Plasmid#180407Purposelentiviral transduction of human TGM2 transcript variant 2 (with a C-terminal Flag tag) geneDepositorAvailable SinceDec. 1, 2022AvailabilityAcademic Institutions and Nonprofits only -
pT7II-1N3Rtau
Plasmid#249552PurposeRecombinant protein synthesis of 1N3R isoform of human TauDepositorInsertTau (1N3R) (MAPT Human)
ExpressionBacterialAvailable SinceJan. 22, 2026AvailabilityAcademic Institutions and Nonprofits only -
pT7II-0N3Rtau
Plasmid#249553PurposeRecombinant protein synthesis of 0N3R isoform of human TauDepositorInsertTau (0N3R) (MAPT Human)
ExpressionBacterialAvailable SinceJan. 22, 2026AvailabilityAcademic Institutions and Nonprofits only