We narrowed to 16,804 results for: OMP;
-
Plasmid#63139PurposeExpression of murine Ring 1b (1-159 aa) and Bmi1 (1-109 aa)DepositorTagsGSTExpressionBacterialMutationResidues 1-109 and Residues 1-159PromotertacAvailable sinceMarch 16, 2015AvailabilityAcademic Institutions and Nonprofits onlyCited by
-
HC078 (3xHA-Atg13)
Plasmid#59544PurposeExpresses yeast Atg13 under the endogenous promoter with a 3xHA N-terminal tagDepositorInsertATG13 (ATG13 Budding Yeast)
Tags3xHAExpressionBacterial and YeastMutationAvrII site created after start codonPromoterATG13Available sinceOct. 7, 2014AvailabilityAcademic Institutions and Nonprofits onlyCited by -
His-MBP human SPOP (aa 28-337)
Plasmid#52294Purposebacterial expression of human SPOP (aa 28-337) fused to His-MBPDepositorAvailable sinceApril 11, 2014AvailabilityAcademic Institutions and Nonprofits only -
pLKO.1 MP1 shRNA
Plasmid#26632DepositorPublicationAvailable sinceNov. 17, 2010AvailabilityAcademic Institutions and Nonprofits only -
pCI-neo-Myc-hAtg14
Plasmid#24293DepositorAvailable sinceSept. 15, 2010AvailabilityAcademic Institutions and Nonprofits onlyCited by -
pYPQ210
Plasmid#109329PurposeMultisite Gateway T-DNA entry plasmid (attR1 & attR2); Zea mays Ubi1 promoter and bar gene for plant selectionDepositorTypeEmpty backboneUseGateway compatible attr1-attr2 destination vectorExpressionPlantAvailable sinceJune 13, 2018AvailabilityAcademic Institutions and Nonprofits only -
pLVX-BSD-tet-mEGFP-MIB1
Plasmid#140241PurposeLentiviral vector expressing mEGFP-tagged MIB1 upon tetracycline treatmentDepositorInsertTet-inducible mEGFP-MIB1 (MIB1 Human)
UseLentiviralTagsmEGFPExpressionMammalianPromoterTREAvailable sinceJune 17, 2020AvailabilityAcademic Institutions and Nonprofits only -
pdRBFC-NS1-YC
Plasmid#74724PurposeExpress C-terminal YC fused influenza A virus partial NS1 protein (27-236 nt) for dsRNA labelingDepositorInsertInfluenza A virus NS1 protein, partial
UseDouble-stranded rna labelingTagsFLAG and YFP C-terminal half domainExpressionPlantPromoterCaMV 35SAvailable sinceMay 9, 2016AvailabilityAcademic Institutions and Nonprofits only -
prsTagRFP-N1
Plasmid#31925DepositorHas service50 µg Transfection-Ready DNA and 100 µg Transfection-Ready DNAInsertrsTagRFP
ExpressionMammalianMutationF84W/I125L/N148A/S165G/F181L/K189N/Y200F compared…PromoterCMVAvailable sinceSept. 12, 2011AvailabilityAcademic Institutions and Nonprofits only -
pcDNA5/FRT/TO HSPA6
Plasmid#19459DepositorHas service50 µg Transfection-Ready DNA and 100 µg Transfection-Ready DNAInsertHSPA6 (HSPA6 Human)
ExpressionMammalianAvailable sinceOct. 7, 2008AvailabilityAcademic Institutions and Nonprofits only -
pPro24(s)-gfp
Plasmid#17813DepositorInsertGFPuv
UseSynthetic BiologyExpressionBacterialMutationD234N compared to AF007834Available sinceMay 16, 2008AvailabilityAcademic Institutions and Nonprofits only -
pAB1676 REPAIR.t1
Plasmid#176319PurposeCMV-HIVNES-GS-dCas13bt1- (GGS)2-huADAR2dd(E488Q) (REPAIR.t1 expression)DepositorHas service50 µg Transfection-Ready DNA and 100 µg Transfection-Ready DNAInsertsUseCRISPRTagsHIV NESExpressionMammalianMutationE488Q, only the deaminase domain (aa 276-702 are …PromoterCMVAvailable sinceOct. 14, 2021AvailabilityAcademic Institutions and Nonprofits only -
pCDF-5xT7-TtCsm
Plasmid#128572PurposeFor expression of T. thermophilus Csm in E. coli (Csm1-5)DepositorInsertsCsm1
Csm2, Csm3, Csm4, Csm5
TagsHRV 3C protease cleavage site and 10xHis tag on C…ExpressionBacterialMutationCodon optimized for expression in E. coli and Cod…PromoterT7 promoter, lac operatorAvailable sinceAug. 6, 2019AvailabilityAcademic Institutions and Nonprofits onlyCited by -
pGP-AAV-CAG-FLEX-jGCaMP7c variant 1513-WPRE
Plasmid#105323PurposeAAV-mediated expression of ultrasensitive protein calcium sensor under the CAG promoter, Cre-dependent expressionDepositorInsertjGCaMP7c variant 1513
UseAAV and Cre/LoxTagsT7 epitope, Xpress tag, 6xHisExpressionMammalianPromoterCAGAvailable sinceJan. 23, 2018AvailabilityAcademic Institutions and Nonprofits only -
pZS2oxySp-GFP-proD-oxyR
Plasmid#78224Purposesynthetic gene circuitDepositorHas service50 µg Transfection-Ready DNA and 100 µg Transfection-Ready DNAInsertsynthetic gene circuit
Available sinceMay 11, 2017AvailabilityAcademic Institutions and Nonprofits only -
pAR015 Lenti pEF-dEnAsCas12a-NLS-NFZ-3XHA-T2A-BSD
Plasmid#195544PurposedCas12a effector fusion for manipulating transcriptionDepositorInsertLenti pEF-dEnAsCas12a-NLS-NFZ-3XHA-T2A-BSD
UseCRISPR and LentiviralTags3XHAExpressionMammalianPromoterpEF1aAvailable sinceMay 6, 2024AvailabilityAcademic Institutions and Nonprofits only -
pBFC0996
Plasmid#186695PurposeVcDART under control of Lac promoter, Vc_2xBsaI_NT gRNA, 2xLguI cargo stuffer, with ET-Seq (AsiSI+SbfI) restriction sites flanking Tn7 Right EndDepositorInsertstnsA
tnsB
tnsC
tnsD
tniQ
cas8-cas5 fusion
cas7
cas6
crRNA
Tn7 transposon
2xLguI Cargo Stuffer
SbfI+AsiSI dual restriction site for donor plasmid removal during ET-Seq
ExpressionBacterialPromoterPLacAvailable sinceSept. 9, 2022AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP6-Myc-FLAG (puromycin)
Plasmid#86851Purposemammalian expression of ATP6 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorHas service50 µg Transfection-Ready DNA and 100 µg Transfection-Ready DNAInsertATP6 (ATP6 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon correctedPromoterCMVAvailable sinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits onlyCited by -
3xFLAG-SENP6
Plasmid#42887DepositorPublicationHas service50 µg Transfection-Ready DNA and 100 µg Transfection-Ready DNAInsertSENP6 (SENP6 Human)
Tags3xFLAGExpressionMammalianMutationPlease see depositor commentsAvailable sinceApril 23, 2013AvailabilityAcademic Institutions and Nonprofits only -
pcDNA5/FRT/TO V5 DNAJA3
Plasmid#19520DepositorInsertDnaJ (Hsp40) homolog, subfamily A, member 3 (DNAJA3 Human)
TagsV5ExpressionMammalianMutationF193L based on NP_005138.3Available sinceOct. 6, 2008AvailabilityAcademic Institutions and Nonprofits only