We narrowed to 23,514 results for: ESC
-
Plasmid#154013PurposeExpression vector based on the iOn integration-coupled transcriptional switch (Kumamoto et al bioRxiv 2019), equipped with an MCS to clone-in genes of interest and express it from a CAG promoterDepositorInsertMCS
ExpressionMammalianPromoterCAGAvailable SinceJuly 29, 2020AvailabilityAcademic Institutions and Nonprofits only -
pEB2-mScarlet
Plasmid#104006PurposePlasmid encoding mScarletDepositorInsertmScarlet
UseLow copyExpressionBacterialMutationMutations relative to DsRed (MSKGE AVIKEF… N6A, R…PromoterproCAvailable SinceDec. 27, 2017AvailabilityAcademic Institutions and Nonprofits only -
CMV-mito-LAR-GECO1.2
Plasmid#61245PurposeExpresses LAR-GECO1.2 in the mitochondria in mammalian cellsDepositorInsertLAR-GECO1.2
Tagsa duplex of the mitochondrial targeting signal of…ExpressionMammalianMutationSubstitutions relative to R-GECO1.2: N45I/A47R/E1…PromoterCMVAvailable SinceMarch 27, 2015AvailabilityAcademic Institutions and Nonprofits only -
pAAV.hSynapFLEX.(cyto).iGlucoSnFR2.mRuby3
Plasmid#244099PurposeCytosolic expression of green glucose sensor with non-responsive mRuby3DepositorInsertiGlucoSnFR2.mRuby3
UseAAVTagsmRuby3Available SinceSept. 23, 2025AvailabilityAcademic Institutions and Nonprofits only -
aTY135_mtk02_pCAG-nfGFPtether_P2A_H2B-IRFP_SV40pA
Plasmid#225350Purposepiggyback backbone for non-fluorescent GFP tether and H2B-IRFP expressionDepositorInsertH2B (H2B Human, Synthetic)
TagsmiRFP and non-fluorescent GFP (Y67F)-P2AExpressionMammalianAvailable SinceDec. 20, 2024AvailabilityAcademic Institutions and Nonprofits only -
AA061
Plasmid#216018PurposeFragmid fragment: (Cas protein) nickase Cas for prime editingDepositorHas ServiceCloning Grade DNAInsertnCas9-NG (H840A)_v1.1 [Sp]
UseCRISPR; FragmentAvailable SinceApril 29, 2024AvailabilityAcademic Institutions and Nonprofits only -
pAAV.CAG.(mem).iGlucoSnFR2.mRuby3
Plasmid#244075PurposePlasma membrane targeted expression of green glucose sensor with non-responsive mRuby3DepositorInsertiGlucoSnFR2.mRuby3
UseAAVTagsIgG kappa leader and mRuby3Available SinceOct. 24, 2025AvailabilityAcademic Institutions and Nonprofits only -
pcDNA HA DUSP6
Plasmid#236430Purposetransient overexpression of DUSP6 in mammalian cellsDepositorInsertDUSP6 (DUSP6 Human)
ExpressionMammalianAvailable SinceMay 28, 2025AvailabilityAcademic Institutions and Nonprofits only -
AA029
Plasmid#216009PurposeFragmid fragment: (Cas protein) nickase Cas for base editingDepositorHas ServiceCloning Grade DNAInsertnCas9-NG (D10A)_v1.1 [Sp]
UseCRISPR; FragmentAvailable SinceApril 29, 2024AvailabilityAcademic Institutions and Nonprofits only -
XLone-Puro Cas13d-eGFP U6 BbsI
Plasmid#155184PurposePiggybacTransposon-based tunable and temporal expression control of Cas13d- eGFP and U6 gRNA backboneDepositorTypeEmpty backboneUseUnspecified; Piggybac transposonExpressionMammalianPromoterU6Available SinceJune 24, 2021AvailabilityAcademic Institutions and Nonprofits only -
pAAV-gfaABC1D-R-iLACCO1.1
Plasmid#208103PurposeBiosensor for intracellular L-lactateDepositorInsertdeLACCO1
UseAAVAvailable SinceNov. 14, 2023AvailabilityAcademic Institutions and Nonprofits only -
pGWB405-TIC21-sGFP
Plasmid#213865PurposeBinary vector for the expression of sGFP flanked with an N-terminal chloroplas inner envelope membrane transit peptide in plants .DepositorInsertchloroplast inner envelope membrane transit peptide (TIC21 Mustard Weed)
ExpressionBacterial and PlantAvailable SinceApril 8, 2024AvailabilityAcademic Institutions and Nonprofits only -
mRuby2-SiT-N-15
Plasmid#55912PurposeLocalization: Golgi TGN, Excitation: 559, Emission: 600DepositorAvailable SinceMarch 10, 2015AvailabilityIndustry, Academic Institutions, and Nonprofits -
pAcGP67A-mTLR4ecd-VLR
Plasmid#187877PurposeBaculovirus protein expression of mouse TLR4 (residues 26–544) fused with hagfish variable lymphocyte receptor (VLR) (residues 126–200)DepositorAvailable SinceOct. 7, 2025AvailabilityAcademic Institutions and Nonprofits only -
pAAV.GFAP.(cyto).iGlucoSnFR2.mRuby3
Plasmid#244084PurposeCytosolic expression of green glucose sensor with non-responsive mRuby3DepositorInsertiGlucoSnFR2.mRuby3
UseAAVTagsmRuby3Available SinceSept. 16, 2025AvailabilityAcademic Institutions and Nonprofits only -
pCMV-GalT-mCherry
Plasmid#214271PurposeMammalian expression of GalT-mCherry (Golgi marker)DepositorAvailable SinceFeb. 21, 2024AvailabilityAcademic Institutions and Nonprofits only -
ITPKA-mTurquoise2
Plasmid#137811PurposeIn vivo visualization of actin cytoskeleton (can be used for colocalization studies)DepositorAvailable SinceFeb. 27, 2020AvailabilityAcademic Institutions and Nonprofits only -
pSP6-RNAP
Plasmid#48143PurposeShuttle vector E. coli/B.meg.; encoding the RNA polymerase of the phage SP6 under control of the xylose inducible promoter PxylADepositorInsertrna polymerase SP6
UseSynthetic BiologyExpressionBacterialMutationV314A (numbering based on NCBI Sequence ID: NP_85…Available SinceOct. 21, 2013AvailabilityAcademic Institutions and Nonprofits only -
pAAV-hSyn-HA-eLACCO2.1-NGR
Plasmid#208096PurposeBiosensor for extracellular L-lactateDepositorInserteLACCO2.1
UseAAVAvailable SinceNov. 14, 2023AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only