We narrowed to 16,359 results for: OMP;
-
Plasmid#86851Purposemammalian expression of ATP6 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP6 (ATP6 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon correctedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pETM6-At4CL-PhCHS-CmCHI (C5 mutant, pFlavo-opt)
Plasmid#73404PurposeExpresses three enzymes to convert phenylpropanoic acids to flavanones in vivoDepositorInsertsAt4CL
PhCHS
CmCHI
ExpressionBacterialPromoterT7Available SinceMarch 1, 2016AvailabilityAcademic Institutions and Nonprofits only -
p2R3a-TagRFP-OcsT
Plasmid#71270PurposeEntry clone containing TagRFP. Can be fused with linker to the C-terminal end of protein of interest. For use in plants and compatible with the MultiSite Gateway systemDepositorInsertTagRFP
UseGateway CloningTags4xGly linker and octaline synthase terminatorAvailable SinceDec. 7, 2015AvailabilityAcademic Institutions and Nonprofits only -
pCol2 flu CIITA (P#294)
Plasmid#14651DepositorAvailable SinceJune 30, 2008AvailabilityAcademic Institutions and Nonprofits only -
pCAG-ASAP3ER
Plasmid#195356PurposeASAP3ER under the control of the pCAG promoterDepositorInsertASAP3ER
TagsGFPExpressionMammalianPromoterpCAGAvailable SinceMarch 1, 2023AvailabilityAcademic Institutions and Nonprofits only -
pHRdSV40_scFv_GCN4_sfGFP-VPR-GB1_NLS
Plasmid#79373PurposeRecruits VPR to a compatible Cas9 protein for transcriptional activationDepositorInsertGCN4-sfGFP-VPR
UseCRISPRExpressionMammalianAvailable SinceOct. 26, 2017AvailabilityAcademic Institutions and Nonprofits only -
pIC111
Plasmid#44435DepositorTypeEmpty backboneUseRetroviralTagsEGFP, His, and PreScission cleavage site (2x)ExpressionMammalianAvailable SinceApril 26, 2013AvailabilityAcademic Institutions and Nonprofits only -
pAB1677 REPAIR.t3
Plasmid#176320PurposeCMV-HIVNES-GS-dCas13bt3- (GGS)2-huADAR2dd(E488Q) (REPAIR.t3 expression)DepositorInsertsUseCRISPRTagsHIV NESExpressionMammalianMutationE488Q, only the deaminase domain (aa 276-702 are …PromoterCMVAvailable SinceOct. 14, 2021AvailabilityAcademic Institutions and Nonprofits only -
pDEST47-CYFIP1.GFP
Plasmid#109139PurposeGFP-tagged CYFIP1 expression constructDepositorAvailable SinceFeb. 7, 2019AvailabilityAcademic Institutions and Nonprofits only -
pEGB3 Pnos:Luciferase:Tnos-SF-35S:Renilla:Tnos-35S:P19:Tnos-SF (GB1116)
Plasmid#68218PurposeModule composed of 3 transcriptional units: Luciferase and Renilla proteins, and the Tomato bushy stunt virus (TBSV) silencing suppressor P19 plant expressionDepositorInsertLuc / Renilla / P19
UseLuciferase and Synthetic BiologyExpressionPlantMutationBsaI and BsmBI sites removedPromoterPnos / 35S / 35SAvailable SinceMarch 16, 2016AvailabilityAcademic Institutions and Nonprofits only -
pGEX6p2rbs-GST-Ring1b(1-159)-Bmi1(1-109)
Plasmid#63139PurposeExpression of murine Ring 1b (1-159 aa) and Bmi1 (1-109 aa)DepositorTagsGSTExpressionBacterialMutationResidues 1-109 and Residues 1-159PromotertacAvailable SinceMarch 16, 2015AvailabilityAcademic Institutions and Nonprofits only -
HC078 (3xHA-Atg13)
Plasmid#59544PurposeExpresses yeast Atg13 under the endogenous promoter with a 3xHA N-terminal tagDepositorInsertATG13 (ATG13 Budding Yeast)
Tags3xHAExpressionBacterial and YeastMutationAvrII site created after start codonPromoterATG13Available SinceOct. 7, 2014AvailabilityAcademic Institutions and Nonprofits only -
His-MBP human SPOP (aa 28-337)
Plasmid#52294Purposebacterial expression of human SPOP (aa 28-337) fused to His-MBPDepositorAvailable SinceApril 11, 2014AvailabilityAcademic Institutions and Nonprofits only -
pLKO.1 MP1 shRNA
Plasmid#26632DepositorAvailable SinceNov. 17, 2010AvailabilityAcademic Institutions and Nonprofits only -
pCI-neo-Myc-hAtg14
Plasmid#24293DepositorAvailable SinceSept. 15, 2010AvailabilityAcademic Institutions and Nonprofits only -
pYPQ210
Plasmid#109329PurposeMultisite Gateway T-DNA entry plasmid (attR1 & attR2); Zea mays Ubi1 promoter and bar gene for plant selectionDepositorTypeEmpty backboneUseGateway compatible attr1-attr2 destination vectorExpressionPlantAvailable SinceJune 13, 2018AvailabilityAcademic Institutions and Nonprofits only -
pCSCherryN5icd
Plasmid#22456DepositorAvailable SinceDec. 10, 2009AvailabilityAcademic Institutions and Nonprofits only -
pPro24(s)-gfp
Plasmid#17813DepositorInsertGFPuv
UseSynthetic BiologyExpressionBacterialMutationD234N compared to AF007834Available SinceMay 16, 2008AvailabilityAcademic Institutions and Nonprofits only -
pBS mPax1 (CT#1007)
Plasmid#13898DepositorInsertPax1 (Pax1 Mouse)
ExpressionBacterialAvailable SinceFeb. 16, 2007AvailabilityAcademic Institutions and Nonprofits only -
pKLV-EF1a-mCherryBCL11B-W
Plasmid#208758PurposeLentiviral vector expressing mCherry fused with BCL11B cDNADepositorInsertBCL11B (BCL11B Human)
UseLentiviralAvailable SinceJan. 17, 2024AvailabilityAcademic Institutions and Nonprofits only