We narrowed to 12,111 results for: LEA
-
Plasmid#78458PurposeInducible expression in E. coliDepositorInsertHuman Cleavage Factor lm 25 kDa subunit (NUDT21 Human)
TagsHis and MBPExpressionBacterialPromotertacAvailable sinceJuly 22, 2016AvailabilityAcademic Institutions and Nonprofits only -
TALEN-CCR5R18-CtermQ7
Plasmid#51443PurposeExpresses TALEN targeting right CCR5A site (R18) with Q7 C-terminal domainDepositorInsertTALEN CCR5 Right (R18) Q7 C-term
UseTALENTags3xFLAG and Fok1 KK variantExpressionMammalianMutationK777Q, K778Q, K788Q, R789Q, R792Q, R793Q and R801QPromoterCMVAvailable sinceApril 1, 2014AvailabilityAcademic Institutions and Nonprofits only -
ND4.2-Left TALE-G1397-N-DddA11
Plasmid#179681PurposeExpression of base editor in mammalian cellsDepositorInsertCOX8a MTS_3xFLAG_ND4.2 Left TALE_2aa_DddA G1397-N (S1330I A1341V N1342S E1370K T1380I)_1xUGI_ATP5B 3'UTR
ExpressionMammalianMutationS1330I A1341V N1342S E1370K T1380IAvailable sinceApril 4, 2022AvailabilityAcademic Institutions and Nonprofits only -
hP2X3-cALFA
Plasmid#160499PurposeFor the expression of human P2X3 with ALFA tag at C-terminus in mammalian cellsDepositorInserthuman P2X3 (P2RX3 Synthetic, Human)
TagsHRV3C protease cleavage site-ALFA tag-twin Strep …ExpressionMammalianMutationΔN5ΔC33-T13P/S15V/V16IAvailable sinceJan. 4, 2021AvailabilityAcademic Institutions and Nonprofits only -
pLVX-EF1a-EGFP-Membrin-IRES-Puromycin
Plasmid#134865PurposeExpresses EGFP-tagged Golgi apparatus markerDepositorAvailable sinceMarch 3, 2020AvailabilityAcademic Institutions and Nonprofits only -
NES-EGFP-cPHx2
Plasmid#116854PurposePI(3,4)P2 biosensorDepositorInsertPLEKHA1 (PLEKHA1 Human)
TagsEGFP and X.leavis map2k1.L(32-44)ExpressionMammalianMutationamino acids 169-329 (tandem dimer)Available sinceOct. 11, 2018AvailabilityAcademic Institutions and Nonprofits only -
RINS1(mut)
Plasmid#107291PurposePlasmid for the expression of the inactive mutant of RINS1 sensorDepositorInsertRINS1(mut)
TagssfGFPExpressionMammalianMutationtwo Arg/Ser mutations at the beginning and in the…PromoterCMVAvailable sinceMay 1, 2018AvailabilityAcademic Institutions and Nonprofits only -
pTriEX-Antenna-GDI Cdc42
Plasmid#101681Purpose"Cdc42 was modified with a FRET ‘binding antenna’ that selectively reported Cdc42 binding to endogenous GDI..." -Hodgson et alDepositorInsertCdc42 (CDC42 Human)
Tags6xHis and FRET Antenna (mCerulean-cpVenus)ExpressionBacterial, Insect, and Mamm…PromoterCMVAvailable sinceMarch 23, 2018AvailabilityAcademic Institutions and Nonprofits onlyCited by -
pOTTC414 - pAAV EF1a hPREP
Plasmid#59967PurposeAn AAV packaging vector that expresses hPREP under control of the EF1a promoter.DepositorAvailable sinceOct. 8, 2014AvailabilityAcademic Institutions and Nonprofits onlyCited by -
FLAG-Pol-II CC
Plasmid#35180DepositorPublicationInsertRPBI (POLR2A Human)
TagsFLAGExpressionMammalianMutationContains C-terminal domain repeats (1-22)X2PromoterCMVAvailable sinceMarch 30, 2012AvailabilityAcademic Institutions and Nonprofits only -
pEGFP-C1-PRKAA1ΔC
Plasmid#30306DepositorInsertAMP-activated Protein Kinase α1 ΔC (Prkaa1 Rat)
TagsGFPExpressionMammalianMutationdeleted amino acids Pro 526 to Gln 548Available sinceAug. 26, 2011AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-ABKAR(T/A)
Plasmid#140052PurposeNegative control mutant for ABKAR biosensor.DepositorInsertABKAR(T/A)
Tags6xHIS - T7 tag (gene 10 leader) - Xpress (TM) tag…ExpressionMammalianMutationTarget Thr residue in substrate domain mutated to…PromoterCMVAvailable sinceNov. 21, 2020AvailabilityAcademic Institutions and Nonprofits only -
pUB-nSypHer (NLS:sypHer:NLS)
Plasmid#84731PurposeExpresses sypHer in plant cells-biosensor for pH targeted to NucleiDepositorInsertnSypHer
TagsNLS (nuclear localisation signal and NLS (nuclear…ExpressionPlantPromoterubiqutin- 10 gene promoter (pUBQ10) of ArabidopsisAvailable sinceJuly 6, 2017AvailabilityAcademic Institutions and Nonprofits only -
SUMO_TwinStrep_Cas7-11_crRNA
Plasmid#197612PurposeFor protein purification of Cas7-11DepositorInsertSUMO_TwinStrep_Cas7-11 with crRNA
ExpressionBacterialAvailable sinceAug. 21, 2023AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-AKAP79-AKAR4
Plasmid#181957PurposeGenetically encoded FRET-based PKA activity reporter fused to AKAP79.DepositorInsertAKAP79-AKAR4 (AKAP5 Human)
TagsAKAP79, Cerulean, HIS tag, and cpVenus(E172)ExpressionMammalianPromoterCMVAvailable sinceJune 2, 2022AvailabilityAcademic Institutions and Nonprofits only -
pBK092
Plasmid#183146PurposepET-6xHis-MBP-TEV-CrtTIR-APAZ/CrtAgo - Heterologous CrtSPARTA expressionDepositorInsertCrtSPARTA operon (6xHis-MBP-CrtTIR-APAZ and CrtAgo)
Tags6xHis and MBPExpressionBacterialPromoterT7Available sinceApril 21, 2022AvailabilityAcademic Institutions and Nonprofits onlyCited by -
EC2_3_dCas9_Mxi1_sgRNA
Plasmid#163708PurposeYeast low copy plasmid with dCas9, sgRNA expression cassette and Mxi1 transcriptional repressorDepositorInsertsdCas9
Mxi1+SV40 NLS
ExpressionYeastMutationPoint mutations D10A and H840APromoterScTEF1Available sinceNov. 1, 2021AvailabilityAcademic Institutions and Nonprofits only -
DiLiCre 2.0
Plasmid#198752PurposeA Cre recombinase that is expressed upon doxycycline when combined with the UbC-blasticidine-P2A-TETon-3G transactivator. DiLiCre 2.0 is a cre recombinase that is activated by violet light.DepositorInsertCre-PhoCI-ERT2-ERT2
UseLentiviralTagsCre, kept in a photocleavable site, followed by 2…ExpressionBacterial and MammalianPromoterTRE3GVAvailable sinceJuly 7, 2023AvailabilityAcademic Institutions and Nonprofits only -
pcDNA5-FRT/TO-3*Flag-APEX2 N-term NONO
Plasmid#187580PurposeExpress FLAG epitope and APEX2-tagged NONO fusion protein in mammalian cellsDepositorAvailable sinceJuly 28, 2022AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP8-Myc-FLAG (G418)
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable sinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only