We narrowed to 12,028 results for: LEA
-
Plasmid#86850Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP8 (ATP8 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon optimizedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pVoPo-02
Plasmid#187837PurposeBackbone for translational reporter system in Fusobacterium nucleatumDepositorTypeEmpty backboneExpressionBacterialAvailable SinceSept. 6, 2023AvailabilityAcademic Institutions and Nonprofits only -
HA-BACE1-mBFP
Plasmid#196697PurposeExpresses Bace1 with an HA tag at N-terminal for single molecule tracking and other measusers in mammalian cellsDepositorAvailable SinceApril 26, 2023AvailabilityAcademic Institutions and Nonprofits only -
pET28a-TEV-TBP6.9F34MF37MF77M
Plasmid#168268PurposeExpresses human TBP6.9 with the F34M/F37M/F77M triple mutantDepositorInsertTBP6.9
Tags6xHis tag N-terminus, TEV protease cleavage siteExpressionBacterialMutationchanged F34M, F37M and F77MPromoterT7 promotorAvailable SinceApril 16, 2021AvailabilityAcademic Institutions and Nonprofits only -
pMINTC3H
Plasmid#110075PurposeAnalogous to pMINTNH3 but with a C-terminal 3C cleavage site and His10 tag.DepositorTypeEmpty backboneTags3C cleavage site - His10 TagExpressionBacterialAvailable SinceJune 5, 2018AvailabilityAcademic Institutions and Nonprofits only -
pPM180
Plasmid#64822PurposeGUS overexpression in plantaDepositorInsertGUS
ExpressionPlantAvailable SinceSept. 2, 2015AvailabilityAcademic Institutions and Nonprofits only -
Membrane mNeonGreen
Plasmid#198057PurposePlasma membrane localizing mNeonGreen using Human LCK proto-oncogene sequenceDepositorInsertLCK membrane mNeonGreen (LCK Human, A.victoria)
UseSynthetic Biology; Sea urchin, mammal, zebrafishTagsmNeonGreenMutationTandem repeat of N-terminal LCK membrane targetin…Promotersp6Available SinceMarch 30, 2023AvailabilityAcademic Institutions and Nonprofits only -
pK27Sumo_His-SUMO-nsp8 (SARS-CoV-2)
Plasmid#169187PurposeTo express His-SUMO-nsp8 (SARS-CoV-2) in E. coliDepositorInsert14His-SUMO-nsp8 (ORF1ab Synthetic, SARS-CoV-2)
Tags14His-SUMO (Ulp1-cleavable)ExpressionBacterialMutationCodon optimised for E. coliPromoterT5Available SinceJuly 6, 2021AvailabilityAcademic Institutions and Nonprofits only -
Human 3' HP1a AID GFP PuroR
Plasmid#127906PurposeHDR (donor) Plasmid for Inserting AID-GFP-2A-Puro into the 3' end of the Human HP1a GeneDepositorInsertHP1 (CBX5 Human, Mustard Weed)
UseDonor plasmidTagsGFP, AID, PuroRMutationInserting GFP AID 2A Puro into mouse 3' Hp1aAvailable SinceSept. 12, 2019AvailabilityAcademic Institutions and Nonprofits only -
764 pME nls-mApple
Plasmid#195962PurposeGateway pME fluorophoreDepositorInsertmApple nuclear
UseOtherAvailable SinceFeb. 21, 2023AvailabilityAcademic Institutions and Nonprofits only -
Membrane EGFP
Plasmid#198056PurposePlasma membrane localizing EGFP using Human LCK proto-oncogene sequenceDepositorInsertLCK membrane EGFP (LCK Human, A. victoria, Synthetic)
UseSea urchin, mammal, zebrafishTagsEGFPMutationTandem repeat of N-terminal LCK membrane targetin…Promotersp6Available SinceMarch 30, 2023AvailabilityAcademic Institutions and Nonprofits only -
pLVX-EF1a-EGFP-TA MAO-IRES-Puromycin
Plasmid#133025PurposeExpresses EGFP-tagged tail anchor sequence of monoamine oxidase ADepositorInsertMonoamine oxidase type A (MAOA Human)
UseLentiviralTagsEGFPExpressionMammalianMutationdeleted amino acids 1-488PromoterHuman elongation factor 1 alphaAvailable SinceFeb. 7, 2020AvailabilityAcademic Institutions and Nonprofits only -
pTriEX-Antenna-GDI Rac1
Plasmid#83359PurposeExpression of Antenna-Rac1DepositorInsertRac1 (RAC1 Human)
TagsFRET Antenna (mCerulean-cpVenus) and HisExpressionBacterial, Insect, and Mamm…PromoterCMVAvailable SinceMarch 6, 2017AvailabilityAcademic Institutions and Nonprofits only -
pSc1-DD
Plasmid#80439PurposeExpresses eGFP with ecDHFR along with an U6 promoter driven gRNA which cleaves the plasmid in-cellDepositorInsertssp Cas9 gRNA
eGFP
UseCRISPRTagsE. coli dihydrofolate reductaseExpressionMammalianPromoterCMV and U6Available SinceAug. 11, 2016AvailabilityAcademic Institutions and Nonprofits only -
pICSL11055
Plasmid#68252PurposeLevel 1 Golden Gate Cassette: Plant kanamycin resistance cassetteDepositorInsertPromoter:2x35s+5'UTR:Omega+CDS:nptII+3'UTR/terminator:Nos
UseSynthetic BiologyExpressionPlantAvailable SinceSept. 1, 2015AvailabilityAcademic Institutions and Nonprofits only -
pBABE-Flag-Cdk9-T186A-IRES-eGFP
Plasmid#28097DepositorInsertCdk9 (CDK9 Human)
UseRetroviralTagsFLAGExpressionMammalianMutationContains T186A mutation in Cdk9Available SinceApril 15, 2011AvailabilityAcademic Institutions and Nonprofits only -
pBABE-Flag-Cdk9-D167N-IRES-eGFP
Plasmid#28098DepositorInsertCdk9 (CDK9 Human)
UseRetroviralTagsFLAGExpressionMammalianMutationContains D167N mutation in Cdk9Available SinceApril 12, 2011AvailabilityAcademic Institutions and Nonprofits only -
pMSCV PIG IMP-1-long-mut
Plasmid#21661DepositorInsertIGF-II mRNA-binding protein 1 (IGF2BP1 Human)
UseRetroviralTagsGFP and IRESExpressionMammalianMutationmutated let-7 binding sites.Available SinceJuly 28, 2009AvailabilityAcademic Institutions and Nonprofits only -
pMINTC3GH (Hyg)
Plasmid#110077PurposeAnalogous to pMINTNH3 but with a C-terminal 3C cleavage site and a GFP-His10 tag fusion.DepositorTypeEmpty backboneTags3C cleavage site - GFP - His10 TagExpressionBacterialAvailable SinceJune 5, 2018AvailabilityAcademic Institutions and Nonprofits only -
RP1B
Plasmid#26563DepositorTypeEmpty backboneTagsHis6, TEV cleavage site, and Thio-6ExpressionBacterialAvailable SinceNov. 29, 2010AvailabilityAcademic Institutions and Nonprofits only