We narrowed to 6,035 results for: arl
-
Plasmid#71027PurposeGateway entry cloneDepositorInsertlds (lds Fly)
UseGateway entry vectorAvailable SinceDec. 2, 2015AvailabilityAcademic Institutions and Nonprofits only -
pGEX2TK E7 del EDE
Plasmid#13675DepositorAvailable SinceMarch 5, 2007AvailabilityAcademic Institutions and Nonprofits only -
-
pLenti-mCherry-CAAX
Plasmid#129285PurposeLentiviral plasmid for expression of fluorescent reporter mCherry targeted to the plasma membrane via CAAX polybasic sequenceDepositorInsertFluorescent reporter mCherry fused to CAAX polybasic sequence
UseLentiviralTagsCAAXExpressionMammalianPromoterCMV promoterAvailable SinceJune 22, 2022AvailabilityAcademic Institutions and Nonprofits only -
nuclear NAD+ biosensor
Plasmid#186789PurposeNAD+ biosensor comprised of a circularly permuted Venus fluorescent protein (cpVenus), a bipartite NAD+-binding domain modeled from bacterial DNA ligase, and a localization tag to target the nucleusDepositorInsertnuclear NAD+ biosensor
UseLentiviralExpressionMammalianAvailable SinceJuly 28, 2022AvailabilityAcademic Institutions and Nonprofits only -
EGFP-LC3
Plasmid#11546DepositorAvailable SinceApril 4, 2006AvailabilityAcademic Institutions and Nonprofits only -
CLYBL_Bxb1-GA_LP_Dual_TC
Plasmid#229776PurposeCLYBL targeting construct with the Bxb1-GA landing pad cassette.DepositorInsertFRT-mScarlet-attP(GA)-PuroR-F3
UseSynthetic BiologyExpressionMammalianPromoterpGKAvailable SinceFeb. 20, 2025AvailabilityAcademic Institutions and Nonprofits only -
APEX2-OMM
Plasmid#79056PurposeSoybean APEX2 anchored to cytosolic face of outer mitochondrial membrane with C-terminal targeting sequence of last 31aa of human mitochondrial antiviral-signaling proteinDepositorInsertSoybean APEX2
UseLentiviralTagsflag and last 31 amino acids of human MAVSExpressionBacterial and MammalianPromoterCMV immearly promotorAvailable SinceAug. 4, 2016AvailabilityAcademic Institutions and Nonprofits only -
ERM-APEX2
Plasmid#79055PurposeSoybean APEX2 anchored to cytosolic face of ER membrane with N-terminal targeting sequence of residues 1-27 of ER-resident P450 oxidase 2C1.DepositorInsertAPEX2 anchored to the cytosolic face of the ER membrane
UseLentiviralTagsResidues 1-27 of P450 oxidase 2C1 and V5ExpressionBacterial and MammalianPromoterCMV immearly promotorAvailable SinceAug. 4, 2016AvailabilityAcademic Institutions and Nonprofits only -
pLV hUbC-Cas9-T2A-GFP
Plasmid#53190Purpose3rd generation transfer vector. Co-expresses human optimized S. pyogenes Cas9 and GFPDepositorInserthumanized Cas9 T2A GFP
UseCRISPR and LentiviralTagsFlagExpressionMammalianPromoterhUbCAvailable SinceJune 25, 2014AvailabilityAcademic Institutions and Nonprofits only -
pCfB2312 (TEF1p-Cas9-CYC1t_kanMX)
Plasmid#83946PurposeCas9-carrying vector with kanMX markerDepositorInsertCas9
ExpressionYeastAvailable SinceOct. 27, 2016AvailabilityAcademic Institutions and Nonprofits only -
pDEST-EGFP-TARG1
Plasmid#172586PurposeFor transient expression of N-terminal GFP-tagged TARG1DepositorAvailable SinceApril 8, 2022AvailabilityAcademic Institutions and Nonprofits only -
cytoplasmic NAD+ biosensor
Plasmid#186787PurposeNAD+ biosensor comprised of a circularly permuted Venus fluorescent protein (cpVenus), a bipartite NAD+-binding domain modeled from bacterial DNA ligase, and a localization tag to target the cytoplasmDepositorInsertcytoplasmic NAD+ biosensor
UseLentiviralExpressionMammalianAvailable SinceJuly 28, 2022AvailabilityAcademic Institutions and Nonprofits only -
mito NAD+ biosensor
Plasmid#186791PurposeNAD+ biosensor comprised of a circularly permuted Venus fluorescent protein (cpVenus), a bipartite NAD+-binding domain modeled from bacterial DNA ligase, and a localization tag totarget mitochondriaDepositorInsertmito NAD+ biosensor
UseLentiviralExpressionMammalianAvailable SinceJuly 28, 2022AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-neo-Strep_Flag_Cterm
Plasmid#102645PurposeEpitope tag c-terminus with SBP-Flag moietyDepositorTypeEmpty backboneTagsSBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPG…ExpressionMammalianAvailable SinceOct. 19, 2017AvailabilityAcademic Institutions and Nonprofits only -
pLVX-EF1a-EGFP-RAB5A-IRES-Puromycin
Plasmid#134858PurposeExpresses EGFP-tagged early endosome markerDepositorInsertRas-related protein 5A
UseLentiviralTagsEGFPExpressionMammalianPromoterEF1aAvailable SinceMarch 2, 2020AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1/hChR2(H134R)-mCherry
Plasmid#20938PurposeMammalian expression of humanized ChR2 with H134R mutation fused to mCherry for optogenetic activationDepositorInsertchannelrhodopsin-2
ExpressionMammalianMutationH134R mutation in ChR2PromoterCMVAvailable SinceJune 1, 2009AvailabilityAcademic Institutions and Nonprofits only -
pLenti-mCherry-CAAX
Plasmid#166229PurposeLentiviral plasmid for expression of mCherry with a C-terminal CAAX polybasic sequence from KRras targeting mCherry to the plasma membrane.DepositorInsertmCherry-CAAX
UseLentiviralTagsCAAXExpressionMammalianPromoterCMVAvailable SinceJan. 30, 2024AvailabilityAcademic Institutions and Nonprofits only -
pLV hUbC-dCas9 KRAB-T2A-GFP
Plasmid#67620PurposeCo-expressed human optimized S. pyogenese dCas9 fused to KRAB repressor domain and GFPDepositorInserthumanized dead Cas9 KRAB T2A GFP
UseCRISPR and LentiviralTagsFlagMutationD10A and H840AAvailable SinceMarch 19, 2020AvailabilityAcademic Institutions and Nonprofits only -
pLP2
Plasmid#209989PurposeEntry vector to store Level 0 resistance cassette parts and E. coli shuttle part (containing no E. coli ori)DepositorTypeEmpty backboneExpressionBacterialAvailable SinceJan. 17, 2024AvailabilityAcademic Institutions and Nonprofits only