We narrowed to 4,729 results for: TIL
-
Plasmid#41608DepositorInsertGAL1 promoter (GAL1 Budding Yeast)
UseYeast genomic targetingTags3xHA, A. gossypii translation elongation factor 1…Available SinceDec. 10, 2012AvailabilityAcademic Institutions and Nonprofits only -
JH401: pMVP/Ad/RGD-PK-DEST
Plasmid#121846PurposepMVP destination vector, empty RGD/PK fiber-modified adenovirus vector backboneDepositorTypeEmpty backboneUseAdenoviral; Pmvp gateway destination vectorAvailable SinceJune 27, 2019AvailabilityAcademic Institutions and Nonprofits only -
pET21-pelB-LaG-16-4GS-LaG-2
Plasmid#172764PurposeBacterial expression of dimerized anti-GFP nanobodies LaG-16 and LaG-2 (4GS linker)DepositorInsertLaG-16-4GS-LaG-2
Tags6xHIS and pelB leader for periplasmic secretionExpressionBacterialPromoterT7Available SinceAug. 18, 2021AvailabilityAcademic Institutions and Nonprofits only -
GFP-mouse vinculin full length (889)
Plasmid#67935PurposeMammalian expression of mouse vinculin with GFP fusionDepositorAvailable SinceNov. 18, 2015AvailabilityAcademic Institutions and Nonprofits only -
pSB700 lenti gRNA KanR neo
Plasmid#167909PurposeLentiviral vector for expressing U6 sgRNA cloning plasmidDepositorTypeEmpty backboneUseCRISPR and LentiviralAvailable SinceFeb. 14, 2022AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-neo-Strep_Flag_Cterm
Plasmid#102645PurposeEpitope tag c-terminus with SBP-Flag moietyDepositorTypeEmpty backboneTagsSBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPG…ExpressionMammalianAvailable SinceOct. 19, 2017AvailabilityAcademic Institutions and Nonprofits only -
KP201: pMVP (L5-L4) eGFP-P2A
Plasmid#121708PurposepMVP L5-L4 entry plasmid, contains eGFP-P2A for 4-component MultiSite Gateway Pro assembly. Allows expression of N-term eGFP linked by P2A to gene of interest.DepositorInserteGFP-P2A (open)
UseGateway Cloning and Synthetic BiologyAvailable SinceJune 27, 2019AvailabilityAcademic Institutions and Nonprofits only -
pLVX-RT004-LaG30VB
Plasmid#163384Purpose2nd generation lentiviral vector to express anti-GFP(LaG30) module in the G-baToN systemDepositorInsertLaG30-VEEGFRtm-BFP (LaG30VB)
UseLentiviralTagsBFPExpressionBacterial and MammalianPromoterEF1aAvailable SinceJan. 11, 2021AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1-mas-GRK2RH-Nluc
Plasmid#158605PurposePlasmid expressing GRK2(RH)-Nluc in mammalian cellsDepositorInsertmyristic acid attachment peptide (mas; MGSSKSKTSNS) - linker (GIKLGG) - GRK2 RH domain - linker (GGTGGS) - Nluc
ExpressionMammalianPromoterCMVAvailable SinceJune 29, 2021AvailabilityIndustry, Academic Institutions, and Nonprofits -
pCOM-CD63-COM
Plasmid#138350PurposeExpressing COM-CD63-COM fusion protein in mammalian cellsDepositorInsertCOM-CD63-COM fusion protein
UseCRISPR and LentiviralTagsCOM is fused to the N and C termini of human CD63ExpressionMammalianAvailable SinceMarch 22, 2021AvailabilityAcademic Institutions and Nonprofits only -
CVS-N2c-jGCaMP8m
Plasmid#172388PurposeProduction of RVdG-CVS-N2c viral vectors for cell-type specific trans-synaptic retrograde labeling.DepositorInsertGCaMP8m
UseNeurotropic virusAvailable SinceSept. 27, 2021AvailabilityAcademic Institutions and Nonprofits only -
pSIQ-EGFP
Plasmid#216239PurposeAll-in One IQ transgene switch for EGFP expressionDepositorInsertEGFP
UseSynthetic BiologyExpressionMammalianAvailable SinceMay 28, 2024AvailabilityAcademic Institutions and Nonprofits only -
pUb PspCas13b + PspCas13b guide RNA
Plasmid#176305PurposeExpresses PspCas13b and its associated guide RNA in Drosophila cellsDepositorInsertPspCas13b
TagsHA tagExpressionInsectMutationE113K, N265S- please depositor commentsPromoterUbi-p63eAvailable SinceMarch 7, 2022AvailabilityAcademic Institutions and Nonprofits only -
pLVX-RT005-HaloGPM
Plasmid#163385Purpose2nd generation lentiviral vector to express sHalotag-sGFP module in the G-baToN systemDepositorInsertHalotag-GFP-PDGFRtm-2A-mCherry (HaloGPM)
UseLentiviralTagsmCherryExpressionBacterial and MammalianPromoterEF1aAvailable SinceJan. 11, 2021AvailabilityAcademic Institutions and Nonprofits only -
pLV-EF1a-N2c_envA-IRES-Neo
Plasmid#172368PurposeGeneration of envA-expressing stable cell lines, resistant to the antibiotic Neomycin (Gentamicin/G418)DepositorInsertenvA + Neo
UseLentiviralExpressionMammalianPromoterEF1aAvailable SinceAug. 18, 2021AvailabilityAcademic Institutions and Nonprofits only -
pLinker-AID-3xHA-HXGPRT-LoxP
Plasmid#86553Purposeused for a TIR1-AID system with CRISPR tagging technology in Toxoplasma gondiiDepositorInsertLinker-AID-3xHA-HXGPRT 3'UTR
UseExpression in toxoplasma gondiiAvailable SinceMay 4, 2017AvailabilityAcademic Institutions and Nonprofits only -
iTol2Amp-γ-crystallin:RFP
Plasmid#108455PurposeThis plamid can be used to recombine the iTol2-Amp-γ-crystallin:RFP into a BAC.DepositorInsertTol2-Amp-y-cryst-mCherry
UseGateway CloningAvailable SinceSept. 25, 2018AvailabilityAcademic Institutions and Nonprofits only -
pYFJ16-LplA(W37V) (for E. Coli expression)
Plasmid#34838DepositorInsertLplA W37V (lplA E. Coli)
TagsHis TagExpressionBacterialMutationMutated Trp37 to ValPromoterT5 promoterAvailable SinceMay 16, 2012AvailabilityAcademic Institutions and Nonprofits only -
MMLV-CAG-SADB19_oG-IRES-Puro
Plasmid#172367PurposeGeneration of stable cell lines expressing the rabies optimized glycoprotein (oG), resistant to the antibiotic PuromycinDepositorInsertoG + Puro
UseRetroviralExpressionMammalianPromoterCAGAvailable SinceAug. 4, 2021AvailabilityAcademic Institutions and Nonprofits only -
MMLV-CAG-TVA-IRES-Puro
Plasmid#172366PurposeGeneration of TVA-expressing stable cell lines, resistant to the antibiotic PuromycinDepositorInsertTVA + Puro
UseRetroviralExpressionMammalianPromoterCAGAvailable SinceOct. 3, 2021AvailabilityAcademic Institutions and Nonprofits only