We narrowed to 13,472 results for: sequence
-
Plasmid#72593Purposeoverexpression, codon optimized for mammalian expressionDepositorInsertSESN2 (SESN2 Human)
TagsHAExpressionMammalianMutationcodon optimized for mammalian expression, see dep…PromoterCMVAvailable SinceFeb. 2, 2016AvailabilityAcademic Institutions and Nonprofits only -
pTT3 Unc5B-FLAG
Plasmid#72195PurposeExpresses full-length Unc5b with a C-terminal FLAG tagDepositorAvailable SinceFeb. 23, 2016AvailabilityAcademic Institutions and Nonprofits only -
pRS413-TEF1pr-MFA-NFAPoptim
Plasmid#221095PurposeFAP insert for N-terminally tagging genes of interest (optimized FAP for yeast expression + 2xMYC tag) + MFA1 signal sequence to help target constructs to the ERDepositorTypeEmpty backboneExpressionYeastAvailable SinceApril 3, 2025AvailabilityAcademic Institutions and Nonprofits only -
AAV-CAG-FLInChR-mVenus
Plasmid#119298PurposeFLinChR is the fusion signal sequence and transmembrane (TM) domain of Neurexin 1B-delta to ChR2E123T/T159C for inversion ChR2 to an optogenetic inhibitorDepositorInsertNx1BTM-FCS-ChR2ET/TC-mVenus
UseAAVTagsmVenusPromoterCAGAvailable SinceJan. 4, 2019AvailabilityAcademic Institutions and Nonprofits only -
-
pTrc99S-ssDsbA-CRM197-4xDQNAT
Plasmid#128403PurposePeriplasmic expression of CRM197 with C terminal 4xDQNAT glycosylation sites in E. coliDepositorInsertDiphtheria toxin
Tags4xDQNAT glycosylation tag, 6xHis tag, and DsbA si…ExpressionBacterialMutationInactivating G52E mutationPromotertrcAvailable SinceApril 13, 2021AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP6-Myc-FLAG (puromycin)
Plasmid#86851Purposemammalian expression of ATP6 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP6 (ATP6 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon correctedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pCIneo-lambdaN-HA-HsSmg6_I
Plasmid#146551PurposeMammalian Expression of HsSmg6DepositorInsertHsSmg6 (SMG6 Human)
ExpressionMammalianMutationtwo silent mutations T594C, A699G and two non sil…Available SinceMarch 16, 2023AvailabilityAcademic Institutions and Nonprofits only -
LifeAct-14 (LA-14)
Plasmid#158750PurposeLentiviral plasmid for expression of shorter LifeAct variant (up till 14 amino acids) fused with carboxy terminus eGFP in mammalian cells.DepositorInsertLifeAct-14
UseLentiviralTagseGFPExpressionMammalianMutationDeletion mutation for last three amino acids from…PromoterCMV immediate earlyAvailable SinceSept. 9, 2020AvailabilityAcademic Institutions and Nonprofits only -
AMA1-bio
Plasmid#47741PurposeExpresses enzymatically monobiotinylated full-length AMA1 ectodomain with no N-linked glycans upon cotransfection with BirA in mammalian cells. Contains a C-terminal rat Cd4 d3+4 tag.DepositorInsertCodon-optimised AMA1
Tagsenzymatic biotinylation sequence and rat Cd4 d3+4ExpressionMammalianMutationExogenous signal peptide of mouse origin, changed…PromoterCMVAvailable SinceFeb. 4, 2014AvailabilityAcademic Institutions and Nonprofits only -
pAAV-CAG-DIO-NLS-mRuby3-IRES-eGtACR1-ST
Plasmid#109048PurposeAnion channelrhodopsin GtACR1 fused to ER export signal and targeted to the neuronal soma and proximal dendrites under the control of internal ribosome entry sequence in a viral vectorDepositorHas ServiceAAV9InserteGtACR1-ST
UseAAVPromoterCAGAvailable SinceJuly 11, 2018AvailabilityAcademic Institutions and Nonprofits only -
pSJ1726 (pFA6-NATMX-CDC42pr-KAR2SS-GFP1-10)
Plasmid#86421PurposeN-terminal PCR tagging cassette for yeast codon optimized split GFP1-10 with CDC42 promoter and KAR2 signal sequenceDepositorInsertCDC42pr-KAR2SS-GFP1-10
TagsGFP1-10ExpressionYeastAvailable SinceFeb. 14, 2017AvailabilityAcademic Institutions and Nonprofits only -
pWAP-HGF
Plasmid#83503PurposeGeneration of transgenic mice overexpressing the HGF under the control of the WAP gene promoterDepositorInsertHGF (Hgf Mouse)
UseMouse TargetingMutationalso contains beta-globin sequences from pUC198Promotermouse WAP (whey acidic protein)Available SinceFeb. 7, 2017AvailabilityAcademic Institutions and Nonprofits only -
Plxna1-AP-His
Plasmid#71996PurposeExpresses the extracellular region of the PlexinA1 protein, C-terminally fused to alkaline phosphatase + 6X histidine tag.DepositorAvailable SinceFeb. 24, 2016AvailabilityAcademic Institutions and Nonprofits only -
pSL3927 (pDonor(plasmid)_Pse)
Plasmid#200905PurposeEncodes a mini-transposon derived from Pseudoalteromonas Tn7016,with a CmrR cargo, as well as a primer binding site for deep sequencing purposes at pTarget. Total transposon size = 1,087 bp.DepositorInsertMini Tn7016 (pTarget NGS)
ExpressionMammalianAvailable SinceMay 22, 2023AvailabilityAcademic Institutions and Nonprofits only -
pLGB36
Plasmid#135621PurposeSuicide vector for allelic replacement in Bacteroides species including B. fragilis strain 638R, erythromycin selection and aTC-inducible ss-Bfe3 counterselectionDepositorInsertbfe3
UseBacteroides suicide vector with inducible counter…Tagssignal sequence for periplasmic targetingPromoterBacteroides promoter regualted by TetR transcript…Available SinceJan. 22, 2020AvailabilityAcademic Institutions and Nonprofits only -
pH3mCHSH2
Plasmid#101053PurposeThis is a Cryptococcus neoformans mCherry expression vector with G418 drug selection marker and C. neoformans SH2 flanking sequences for genome integration.DepositorInsertCryptococcus mCherry expression plasmid
ExpressionYeastPromoterCryptococcus Histone3 promoterAvailable SinceOct. 26, 2017AvailabilityAcademic Institutions and Nonprofits only -
pUF1-dCas9-GCN5
Plasmid#122509PurposeCombining with the specific sgRNA sequence to activate of the Plasmodium falciparum endogenous gene transcription, through the increasing of H3K9 acetylation.DepositorInsertdCas9-GCN5
UseCRISPRTags3*FLAGMutationdCas9(D10A,H840A)PromoterPfHsp86Available SinceJune 3, 2019AvailabilityAcademic Institutions and Nonprofits only -
pRMC2-sec:msfGFP
Plasmid#194914PurposeTetracycline inducible expression of msfGFP fused to Sec signal peptide in StaphylococciDepositorInsertShine Dalgarno sequence followed by Sec signal peptide fused to monomeric superfolder GFP
UseTetracycline-inducible expression vector for stap…ExpressionBacterialAvailable SinceJuly 11, 2023AvailabilityAcademic Institutions and Nonprofits only -
pAG43
Plasmid#226736PurposeExpresses a reporter for an alpha-helical OMM proteinDepositorAvailable SinceOct. 24, 2024AvailabilityAcademic Institutions and Nonprofits only