We narrowed to 234 results for: G1
-
Plasmid#207516PurposetRNA synthetase/tRNA pair for the in vivo incorporation of 7-Aza-L-Tryptophan (7AW) into proteins in E. coli in response to the amber (TAG) codonDepositorInserttRNA synthetase
ExpressionBacterialPromoterT7Available SinceOct. 31, 2023AvailabilityAcademic Institutions and Nonprofits only -
pRSF-G1(6CNW)RS
Plasmid#222873PurposetRNA synthetase/tRNA pair for the in vivo incorporation of 6-Cyano-L-Tryptophan (6-CN-Trp) into proteins in E. coli in response to the amber (TAG) codonDepositorInserttRNA synthetase
ExpressionBacterialPromoterT7Available SinceDec. 17, 2024AvailabilityAcademic Institutions and Nonprofits only -
pRSF-G1(7CNW)RS
Plasmid#222874PurposetRNA synthetase/tRNA pair for the in vivo incorporation of 7-Cyano-L-Tryptophan (7-CN-Trp) into proteins in E. coli in response to the amber (TAG) codonDepositorInserttRNA synthetase
ExpressionBacterialPromoterT7Available SinceFeb. 10, 2025AvailabilityAcademic Institutions and Nonprofits only -
msHook2 g1 lentiCRISPRv2-mCherry
Plasmid#218652PurposeKnockout vector for mouse Hook2DepositorAvailable SinceAug. 8, 2024AvailabilityAcademic Institutions and Nonprofits only -
TMEM165 g1 LentiCRISPRv2-mCherry
Plasmid#218660PurposeKnockout vector for human TMEM165DepositorAvailable SinceMay 1, 2024AvailabilityAcademic Institutions and Nonprofits only -
GOLIM4 g1 LentiCRISPRv2-mCherry
Plasmid#218662PurposeKnockout vector for human GOLIM4 (GPP130/GOLPH4)DepositorAvailable SinceMay 1, 2024AvailabilityAcademic Institutions and Nonprofits only -
pLentiCRISPRv2-POLB-KO-g1
Plasmid#176090PurposeCas9 plus POLB gRNA #1; contains a puromycin resistance cassetteDepositorAvailable SinceJan. 26, 2022AvailabilityAcademic Institutions and Nonprofits only -
PB-EEA-g1-PGK-Puro
Plasmid#102908PurposePiggyBac transposon system construct for U6 promoter-driven expression of a gRNA targeting EEA-motif. Includes PGK-puro selection cassette.DepositorInsertEEA-guide1-PGK-Puro
UseCRISPRExpressionMammalianPromoterU6Available SinceJuly 10, 2018AvailabilityAcademic Institutions and Nonprofits only -
pRSF-G1(6/7FTrp)RS
Plasmid#207621PurposetRNA synthetase/tRNA pair for the in vivo incorporation of 6-Fluoro-L-Tryptophan (6FTrp) and 7-Fluoro-L-Tryptophan (7FTrp) into proteins in E. coli in response to the amber (TAG) codonDepositorInserttRNA synthetase
ExpressionBacterialPromoterT7Available SinceMay 13, 2024AvailabilityAcademic Institutions and Nonprofits only -
pRSF-G1(4/5FTrp)RS
Plasmid#207620PurposetRNA synthetase/tRNA pair for the in vivo incorporation of 4-Fluoro-L-Tryptophan (4FTrp) and 5-Fluoro-L-Tryptophan (5FTrp) into proteins in E. coli in response to the amber (TAG) codonDepositorInserttRNA synthetase
ExpressionBacterialPromoterT7Available SinceJune 6, 2024AvailabilityAcademic Institutions and Nonprofits only -
pAS_4xG1 PylT FLAG-G1 PylRS
Plasmid#154768Purposeplasmid with 4xG1 PylT cassette and G1 PylRS for amber suppression in transient or stable, piggybac-mediated, integrationDepositorInsertG1 PylRS (MJ_RS07805 methanogenic archaeon mixed culture ISO4-G1)
TagsFLAGExpressionMammalianPromoterEF1Available SinceOct. 1, 2020AvailabilityAcademic Institutions and Nonprofits only -
msFam160b1 (msFHIP2A) g1 lentiCRISPRv2-mCherry
Plasmid#218654PurposeKnockout vector for mouse Fam160b1 (Fhip2A)DepositorAvailable SinceMay 3, 2024AvailabilityAcademic Institutions and Nonprofits only -
msPlekha8 (msFapp2) g1 lentiCRISPRv2-opti
Plasmid#218650PurposeKnockout vector for mouse Plekha8 (Fapp2)DepositorAvailable SinceMay 1, 2024AvailabilityAcademic Institutions and Nonprofits only -
msPlekha3 (msFapp1) g1 lentiCRISPRv2-opti
Plasmid#218648PurposeKnockout vector for mouse Plekha3 (Fapp1)DepositorAvailable SinceMay 1, 2024AvailabilityAcademic Institutions and Nonprofits only -
PLEKHA8 (FAPP2) g1 lentiCRISPRv2-opti
Plasmid#218658PurposeKnockout vector for human PLEKHA8 (FAPP2)DepositorAvailable SinceMay 1, 2024AvailabilityAcademic Institutions and Nonprofits only -
PLEKHA3 (FAPP1) g1 lentiCRISPRv2-opti
Plasmid#218656PurposeKnockout vector for human PLEKHA3 (FAPP1)DepositorAvailable SinceMay 1, 2024AvailabilityAcademic Institutions and Nonprofits only -
HuEx-2xNLS-iGeoCas9(C1)-2xNLS_EGFP-g1
Plasmid#222993PurposeMammalian expression of iGeoCas9(C1) construct with EGFP-targeting sgRNADepositorInsertHuEx-2xNLS-iGeoCas9(C1)-2xNLS_EGFP-g1
UseCRISPRTagsPuroExpressionMammalianPromoterpCAGAvailable SinceJuly 26, 2024AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP6-Myc-FLAG (puromycin)
Plasmid#86851Purposemammalian expression of ATP6 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP6 (ATP6 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon correctedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
pAS_4xG1 PylT FLAG-G1 PylRS Y125A
Plasmid#154769Purposeplasmid with 4xG1 PylT cassette and G1 PylRS Y125A for amber suppression in transient or stable, piggybac-mediated, integrationDepositorInsertG1 PylRS (MJ_RS07805 methanogenic archaeon mixed culture ISO4-G1)
TagsFLAGExpressionMammalianMutationY125APromoterEF1Available SinceOct. 1, 2020AvailabilityAcademic Institutions and Nonprofits only -
HuEx-2xNLS-iGeoCas9(C2)-2xNLS_EGFP-g1
Plasmid#222994PurposeMammalian expression of iGeoCas9(C2) construct with EGFP-targeting sgRNADepositorInsertHuEx-2xNLS-iGeoCas9(C2)-2xNLS_EGFP-g1
UseCRISPRTagsPuroExpressionMammalianPromoterpCAGAvailable SinceJuly 31, 2024AvailabilityAcademic Institutions and Nonprofits only