We narrowed to 4,135 results for: pCMV mammalian
-
Plasmid#172100PurposeMammalian expression of a protein of interest fused to the C-terminus of EGFP-eDHFR(69K6)DepositorInsertEGFP-eDHFR(69K6)-20aa
ExpressionMammalianMutationeDHFR(69K6): Hexalysine (K6) sequence is inserted…PromoterCMVAvailable SinceJuly 14, 2022AvailabilityAcademic Institutions and Nonprofits only -
pCMV-SpCas9(D10A)-T2A-EGFP
Plasmid#221230PurposeExpress nCas9 nickase (D10) with GFP reporterDepositorInsertSpCas9(D10A)-T2A-EGFP
ExpressionMammalianMutationD10AAvailable SinceFeb. 11, 2025AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-G1-ATP6-Myc-FLAG (puromycin)
Plasmid#86851Purposemammalian expression of ATP6 with mitochondrial targeting sequence, Myc, and FLAG tagsDepositorInsertATP6 (ATP6 Human)
TagsATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVN…ExpressionMammalianMutationcodon correctedPromoterCMVAvailable SinceMay 31, 2017AvailabilityAcademic Institutions and Nonprofits only -
PCMV-intron myc Rab6 T27N
Plasmid#46782Purposeexpression of T27N Rab6a in mammalian cellsDepositorInsertRab6 T27N (RAB6A Human)
TagsmycExpressionMammalianMutationT27N dominant negativePromoterCMVAvailable SinceNov. 14, 2013AvailabilityAcademic Institutions and Nonprofits only -
pCMV HA hRB delta CDK + T373
Plasmid#58912Purposemammalian expression of human Rb with all Ser/Thr Cdk acceptor sites removed and T373 restoredDepositorInsertRb (RB1 Human)
TagsHAExpressionMammalianMutationdelta CDK* with T373 restoredPromoterCMVAvailable SinceOct. 2, 2014AvailabilityAcademic Institutions and Nonprofits only -
pCMV-MCS-eDHFR(69K6)-EGFP
Plasmid#172101PurposeMammalian expression of a protein of interest fused to the N-terminus of eDHFR(69K6)-EGFPDepositorInsert22aa-eDHFR(69K6)-EGFP
ExpressionMammalianMutationeDHFR(69K6): Hexalysine (K6) sequence is inserted…PromoterCMVAvailable SinceJuly 14, 2022AvailabilityAcademic Institutions and Nonprofits only -
pCMV-T7-AsCas12a-P2A-EGFP (RTW2861)
Plasmid#160140PurposeCMV and T7 promoter expression plasmid for human codon optimized AsCas12a with a c-terminal NLS(nucleoplasmin), 3x HA tag, and P2A-EGFPDepositorInserthuman codon optimized AsCas12a with NLS(nucleoplasmin)-3xHA-P2A-EGFP
UseIn vitro transcription; t7 promoterTagsNLS(nucleoplasmin)-3xHA-P2A-EGFPExpressionMammalianPromoterCMV and T7Available SinceFeb. 8, 2021AvailabilityAcademic Institutions and Nonprofits only -
pCMV HA hRB delta CDK + S612
Plasmid#58914Purposemammalian expression of human Rb with all Ser/Thr Cdk acceptor sites removed and S612 restoredDepositorInsertRb (RB1 Human)
TagsHAExpressionMammalianMutationdelta CDK* with S612 restoredPromoterCMVAvailable SinceOct. 2, 2014AvailabilityAcademic Institutions and Nonprofits only -
pCMV HA hRB delta CDK + S608
Plasmid#58913Purposemammalian expression of human Rb with all Ser/Thr Cdk acceptor sites removed and S608 restoredDepositorInsertRb (RB1 Human)
TagsHAExpressionMammalianMutationdelta CDK* with S608 restoredPromoterCMVAvailable SinceOct. 2, 2014AvailabilityAcademic Institutions and Nonprofits only -
pCAG_NLS-Cas9-XTEN-Ec73RT-NLS_pA_pCMV_BFP_pA
Plasmid#176458PurposeVector for encoding a human codon-optimized SpCas9-XTEN-Ec73RT fusion driven by CAG promoter and tagBFP driven by CMV promoterDepositorInserthumanized S. pyogenes Cas9-XTEN-Ec73RT fusion
UseCRISPRExpressionMammalianPromoterCAGAvailable SinceOct. 26, 2021AvailabilityAcademic Institutions and Nonprofits only -
pCMV-Lifect-7-pr-mEos2 (mEos2-A69T)
Plasmid#99229PurposeMammalian expression of the primed conversion capable protein pr-mEos2 (mEos2-A69T) as a Lifeact fusion.DepositorInsertpr-mEos2
TagsLifeactExpressionMammalianMutationA69T for primed conversion applicationsPromoterCMVAvailable SinceOct. 6, 2017AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-XL4 ASXL1 (p.Y591X) 3x FLAG
Plasmid#74261PurposeCancer-associated ASXL1 truncation mutant in mammalian expression vectorDepositorInsertASXL1 (ASXL1 Human)
Tags3X FLAGExpressionMammalianMutationp.Y591X truncationPromoterCMVAvailable SinceDec. 21, 2016AvailabilityAcademic Institutions and Nonprofits only -
pCMV HA hRB delta CDK + S780
Plasmid#58915Purposemammalian expression of human Rb with all Ser/Thr Cdk acceptor sites removed and S780 restoredDepositorInsertRb (RB1 Human)
TagsHAExpressionMammalianMutationdelta CDK* with S780 restoredPromoterCMVAvailable SinceOct. 2, 2014AvailabilityAcademic Institutions and Nonprofits only -
pCMV HA hRB delta CDK + S811
Plasmid#58919Purposemammalian expression of human Rb with all Ser/Thr Cdk acceptor sites removed and S811 restoredDepositorInsertRb (RB1 Human)
TagsHAExpressionMammalianMutationdelta CDK* with S811 restoredPromoterCMVAvailable SinceOct. 2, 2014AvailabilityAcademic Institutions and Nonprofits only -
pCMV HA hRB delta CDK + S807
Plasmid#58918Purposemammalian expression of human Rb with all Ser/Thr Cdk acceptor sites removed and S807 restoredDepositorInsertRb (RB1 Human)
TagsHAExpressionMammalianMutationdelta CDK* with S807 restoredPromoterCMVAvailable SinceOct. 2, 2014AvailabilityAcademic Institutions and Nonprofits only -
pCMV HA hRB delta CDK + S788
Plasmid#58916Purposemammalian expression of human Rb with all Ser/Thr Cdk acceptor sites removed and S788 restoredDepositorInsertRb (RB1 Human)
TagsHAExpressionMammalianMutationdelta CDK* with S788 restoredPromoterCMVAvailable SinceOct. 2, 2014AvailabilityAcademic Institutions and Nonprofits only -
pCMV HA hRB delta CDK + T356
Plasmid#58911Purposemammalian expression of human Rb with all Ser/Thr Cdk acceptor sites removed and T356 restoredDepositorInsertRb (RB1 Human)
TagsHAExpressionMammalianMutationdelta CDK* with T356 restoredPromoterCMVAvailable SinceOct. 2, 2014AvailabilityAcademic Institutions and Nonprofits only -
pCMV HA hRB delta CDK + T821
Plasmid#58920Purposemammalian expression of human Rb with all Ser/Thr Cdk acceptor sites removed and T821 restoredDepositorInsertRb (RB1 Human)
TagsHAExpressionMammalianMutationdelta CDK* with T821 restoredPromoterCMVAvailable SinceOct. 2, 2014AvailabilityAcademic Institutions and Nonprofits only -
pCMV6-XL4 ASXL1 (p.R404X) 3x FLAG
Plasmid#74263PurposeCancer-associated ASXL1 truncation mutant in mammalian expression vectorDepositorInsertASXL1 (ASXL1 Human)
Tags3X FLAGExpressionMammalianMutationp.R404X truncationPromoterCMVAvailable SinceDec. 21, 2016AvailabilityAcademic Institutions and Nonprofits only -
pCMV HA hRB delta CDK + T826
Plasmid#58921Purposemammalian expression of human Rb with all Ser/Thr Cdk acceptor sites removed and T826 restoredDepositorInsertRb (RB1 Human)
TagsHAExpressionMammalianMutationdelta CDK* with T826 restoredPromoterCMVAvailable SinceOct. 2, 2014AvailabilityAcademic Institutions and Nonprofits only