We narrowed to 4,729 results for: TIL
-
Plasmid#121849PurposepMVP destination vector, empty Lentivirus vector backbone w/ Blast selection cassetteDepositorTypeEmpty backboneUseLentiviral; Pmvp gateway destination vectorAvailable SinceJune 27, 2019AvailabilityAcademic Institutions and Nonprofits only
-
pSIQmate-EGFP
Plasmid#216241PurposeAll-in One IQ-Cumate transgene switch for the EGFP expressionDepositorInsertEGFP
UseSynthetic BiologyExpressionMammalianAvailable SinceMay 28, 2024AvailabilityAcademic Institutions and Nonprofits only -
pOCC167
Plasmid#118909Purposeshuttle vector for baculovirus production, using FlashBac bacmid; for recombinant protein with honey bee melitine secretion signal and C-terminal HIS6, cleavable with 3C proteaseDepositorInsertNcoI-HBMss-NotI-ccdB-AscI-3C-HIS6-stop-HindIII cassette
TagsHIS6, cleavable with 3C proteaseExpressionInsectPromoterpolHAvailable SinceJan. 2, 2019AvailabilityAcademic Institutions and Nonprofits only -
FL-fibulin-3-V5 pcDNA4
Plasmid#29701DepositorAvailable SinceSept. 6, 2011AvailabilityAcademic Institutions and Nonprofits only -
pH2B-miRFP670nano
Plasmid#127438PurposeHistone 2B labeling with near-infrared fluorescent protein miRFP670nanoDepositorInsertH2B-miRFP670nano (H2BC11 Synthetic, Human)
TagsmiRFP670nanoExpressionMammalianPromoterCMVAvailable SinceJuly 17, 2019AvailabilityAcademic Institutions and Nonprofits only -
pET21a-cys-His6-OtUBD
Plasmid#190091PurposeExpresses OtUBD with a non-cleavable N-terminal 6xHis tag as well as an engineered N-terminal cysteine in E. coliDepositorInsertOtUBD
Tags6xHisExpressionBacterialAvailable SinceOct. 5, 2022AvailabilityAcademic Institutions and Nonprofits only -
pTK331
Plasmid#59572PurposeTC-83 I-SceI T7 5'UTR (A3G) P1234 (nsP2 Q739L) SGP(14) Kozak mKate-G8-L7Ae-PEST 4xFF4 attB2 SGP2(98/30) XbaI attB1 EBFP2 ochre attB2 (insert) AscI (truncated E1) 3'UTR Poly A I-SceIDepositorInsertSGP(16) 2xK-turn Kozak EGFP attB2 AscI
Available SinceAug. 3, 2015AvailabilityAcademic Institutions and Nonprofits only -
pmCherry-C1_SEPT9 i1
Plasmid#71622Purposemammalian expression of human SEPT9 with an mCherry fusionDepositorAvailable SinceDec. 21, 2015AvailabilityAcademic Institutions and Nonprofits only -
pDL17
Plasmid#106483PurposepDL17 is based on conditionally replicating backbone derived from pQE-30 and expresses gam, bet and exo genes under control of PrhaB promoter for efficient dsDNA integration into E. coli chromosomeDepositorInsertsgam
bet
exo
lacI
rhaR
rhaS
ExpressionBacterialAvailable SinceJune 11, 2018AvailabilityAcademic Institutions and Nonprofits only -
pET21-pelB-LaM-3
Plasmid#172769PurposeBacterial expression of anti-mCherry nanobody LaM-3, with pelB leader and C-term free cysteine and 6xHIS tag.DepositorInsertLaM-3
Tags6xHIS and pelB leader for periplasmic secretionExpressionBacterialPromoterT7Available SinceAug. 18, 2021AvailabilityAcademic Institutions and Nonprofits only -
pFA6a-kanMX6-PGAL1-3HA
Plasmid#41608DepositorInsertGAL1 promoter (GAL1 Budding Yeast)
UseYeast genomic targetingTags3xHA, A. gossypii translation elongation factor 1…Available SinceDec. 10, 2012AvailabilityAcademic Institutions and Nonprofits only -
JH401: pMVP/Ad/RGD-PK-DEST
Plasmid#121846PurposepMVP destination vector, empty RGD/PK fiber-modified adenovirus vector backboneDepositorTypeEmpty backboneUseAdenoviral; Pmvp gateway destination vectorAvailable SinceJune 27, 2019AvailabilityAcademic Institutions and Nonprofits only -
pET21-pelB-LaG-16-4GS-LaG-2
Plasmid#172764PurposeBacterial expression of dimerized anti-GFP nanobodies LaG-16 and LaG-2 (4GS linker)DepositorInsertLaG-16-4GS-LaG-2
Tags6xHIS and pelB leader for periplasmic secretionExpressionBacterialPromoterT7Available SinceAug. 18, 2021AvailabilityAcademic Institutions and Nonprofits only -
GFP-mouse vinculin full length (889)
Plasmid#67935PurposeMammalian expression of mouse vinculin with GFP fusionDepositorAvailable SinceNov. 18, 2015AvailabilityAcademic Institutions and Nonprofits only -
pSB700 lenti gRNA KanR neo
Plasmid#167909PurposeLentiviral vector for expressing U6 sgRNA cloning plasmidDepositorTypeEmpty backboneUseCRISPR and LentiviralAvailable SinceFeb. 14, 2022AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-neo-Strep_Flag_Cterm
Plasmid#102645PurposeEpitope tag c-terminus with SBP-Flag moietyDepositorTypeEmpty backboneTagsSBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPG…ExpressionMammalianAvailable SinceOct. 19, 2017AvailabilityAcademic Institutions and Nonprofits only -
KP201: pMVP (L5-L4) eGFP-P2A
Plasmid#121708PurposepMVP L5-L4 entry plasmid, contains eGFP-P2A for 4-component MultiSite Gateway Pro assembly. Allows expression of N-term eGFP linked by P2A to gene of interest.DepositorInserteGFP-P2A (open)
UseGateway Cloning and Synthetic BiologyAvailable SinceJune 27, 2019AvailabilityAcademic Institutions and Nonprofits only -
pLVX-RT004-LaG30VB
Plasmid#163384Purpose2nd generation lentiviral vector to express anti-GFP(LaG30) module in the G-baToN systemDepositorInsertLaG30-VEEGFRtm-BFP (LaG30VB)
UseLentiviralTagsBFPExpressionBacterial and MammalianPromoterEF1aAvailable SinceJan. 11, 2021AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1-mas-GRK2RH-Nluc
Plasmid#158605PurposePlasmid expressing GRK2(RH)-Nluc in mammalian cellsDepositorInsertmyristic acid attachment peptide (mas; MGSSKSKTSNS) - linker (GIKLGG) - GRK2 RH domain - linker (GGTGGS) - Nluc
ExpressionMammalianPromoterCMVAvailable SinceJune 29, 2021AvailabilityIndustry, Academic Institutions, and Nonprofits -
pCOM-CD63-COM
Plasmid#138350PurposeExpressing COM-CD63-COM fusion protein in mammalian cellsDepositorInsertCOM-CD63-COM fusion protein
UseCRISPR and LentiviralTagsCOM is fused to the N and C termini of human CD63ExpressionMammalianAvailable SinceMarch 22, 2021AvailabilityAcademic Institutions and Nonprofits only -
CVS-N2c-jGCaMP8m
Plasmid#172388PurposeProduction of RVdG-CVS-N2c viral vectors for cell-type specific trans-synaptic retrograde labeling.DepositorInsertGCaMP8m
UseNeurotropic virusAvailable SinceSept. 27, 2021AvailabilityAcademic Institutions and Nonprofits only -
pSIQ-EGFP
Plasmid#216239PurposeAll-in One IQ transgene switch for EGFP expressionDepositorInsertEGFP
UseSynthetic BiologyExpressionMammalianAvailable SinceMay 28, 2024AvailabilityAcademic Institutions and Nonprofits only -
pUb PspCas13b + PspCas13b guide RNA
Plasmid#176305PurposeExpresses PspCas13b and its associated guide RNA in Drosophila cellsDepositorInsertPspCas13b
TagsHA tagExpressionInsectMutationE113K, N265S- please depositor commentsPromoterUbi-p63eAvailable SinceMarch 7, 2022AvailabilityAcademic Institutions and Nonprofits only -
pLVX-RT005-HaloGPM
Plasmid#163385Purpose2nd generation lentiviral vector to express sHalotag-sGFP module in the G-baToN systemDepositorInsertHalotag-GFP-PDGFRtm-2A-mCherry (HaloGPM)
UseLentiviralTagsmCherryExpressionBacterial and MammalianPromoterEF1aAvailable SinceJan. 11, 2021AvailabilityAcademic Institutions and Nonprofits only -
pLV-EF1a-N2c_envA-IRES-Neo
Plasmid#172368PurposeGeneration of envA-expressing stable cell lines, resistant to the antibiotic Neomycin (Gentamicin/G418)DepositorInsertenvA + Neo
UseLentiviralExpressionMammalianPromoterEF1aAvailable SinceAug. 18, 2021AvailabilityAcademic Institutions and Nonprofits only -
pLinker-AID-3xHA-HXGPRT-LoxP
Plasmid#86553Purposeused for a TIR1-AID system with CRISPR tagging technology in Toxoplasma gondiiDepositorInsertLinker-AID-3xHA-HXGPRT 3'UTR
UseExpression in toxoplasma gondiiAvailable SinceMay 4, 2017AvailabilityAcademic Institutions and Nonprofits only -
iTol2Amp-γ-crystallin:RFP
Plasmid#108455PurposeThis plamid can be used to recombine the iTol2-Amp-γ-crystallin:RFP into a BAC.DepositorInsertTol2-Amp-y-cryst-mCherry
UseGateway CloningAvailable SinceSept. 25, 2018AvailabilityAcademic Institutions and Nonprofits only -
pYFJ16-LplA(W37V) (for E. Coli expression)
Plasmid#34838DepositorInsertLplA W37V (lplA E. Coli)
TagsHis TagExpressionBacterialMutationMutated Trp37 to ValPromoterT5 promoterAvailable SinceMay 16, 2012AvailabilityAcademic Institutions and Nonprofits only -
MMLV-CAG-SADB19_oG-IRES-Puro
Plasmid#172367PurposeGeneration of stable cell lines expressing the rabies optimized glycoprotein (oG), resistant to the antibiotic PuromycinDepositorInsertoG + Puro
UseRetroviralExpressionMammalianPromoterCAGAvailable SinceAug. 4, 2021AvailabilityAcademic Institutions and Nonprofits only -
MMLV-CAG-TVA-IRES-Puro
Plasmid#172366PurposeGeneration of TVA-expressing stable cell lines, resistant to the antibiotic PuromycinDepositorInsertTVA + Puro
UseRetroviralExpressionMammalianPromoterCAGAvailable SinceOct. 3, 2021AvailabilityAcademic Institutions and Nonprofits only