We narrowed to 4,780 results for: INV-E
-
Plasmid#196893PurposeNeuron-specific expression of Akna fused to mOrange2. Used in combination with Talpha1-iCre-pA plasmidsDepositorAvailable SinceSept. 26, 2023AvailabilityAcademic Institutions and Nonprofits only
-
pCAG-lox-inv[Talpha1-iCre-pA]-lox-Akna-mOrange2
Plasmid#196880PurposeNeuron-specific expression of the centrosomal protein Akna fused to mOrange2DepositorAvailable SinceSept. 25, 2023AvailabilityAcademic Institutions and Nonprofits only -
pCAG-rox-inv[Talpha1-iCre-pA]-rox-mNeonGreen-hCentrin1
Plasmid#196892PurposeNeuron-specific expression of human (h)Centrin fused to mNeonGreen. Used in combination with Talpha1-Dre-pA plasmidsDepositorAvailable SinceMay 17, 2023AvailabilityAcademic Institutions and Nonprofits only -
pCAG-lox-inv[Talpha1-Dre-PA]-lox-2xHA-CAMSAP3
Plasmid#196895PurposeNeuron-specific expression of Calmodulin Regulated Spectrin Associated Protein Family Member 3 (CAMSAP3) fused to 2xHA-tags. Used in combination with Talpha1-iCre-pA plasmidsDepositorAvailable SinceMay 16, 2023AvailabilityAcademic Institutions and Nonprofits only -
pCAG-lox-inv[Talpha1-iCre-pA]-lox-mOrange2-NEDD1-gTBD
Plasmid#196878PurposeNeuron-specific expression of the gamma-tubulin-binding domain (gTBD) of NEDD1 fused to mOrange. Used to displace endogenous gamma-TuRC from the centrosome.DepositorInsertmOrange2-N-gTBD
UseCre/LoxExpressionMammalianPromoterQuimeric CAGAvailable SinceSept. 26, 2023AvailabilityAcademic Institutions and Nonprofits only -
pCAG-lox-inv[Talpha1-iCre-pA]-lox-Nedd1-mOrange2-rCM1
Plasmid#196879PurposeNeuron-specific expression of Need1 fused to mOrange2 and rat (r) Centrosomin motif 1 (CM1). Nedd1 targets CM1 to the centrosome to activate gamma-TuRC.DepositorAvailable SinceSept. 26, 2023AvailabilityAcademic Institutions and Nonprofits only -
pCAG-lox-inv[Talpha1-Dre-pA]-lox-mOrange2-Cdk5rap2-CTD
Plasmid#196881PurposeNeuron-specific expression of the centrosome targeting carboxy-terminal domain (CTD) of Cdk5rap2 fused to mOrange2. Used to displace endogenous Cdk5rap2 from centrosomes.DepositorInsertmOrange2-Cdk5rap2-CTD
UseCre/Lox; Dre/roxExpressionMammalianPromoterQuimeric CAGAvailable SinceMay 16, 2023AvailabilityAcademic Institutions and Nonprofits only -
pTS2334_Tier3(Lenti_inverse)-rtTA-YPet_Puro
Plasmid#169665PurposeTier-3 vector for lentiviral stable integration of the rtTA and puromyine - Ypet selection cassette in inverted direction with polyA (PRPBSA-YPet-p2a-PuroR::PPGK-rtTA-pA::A3-pA)DepositorInsertPPGK-driven rtTA expression and PRPBSA-driven YPet and PuroR expression
ExpressionMammalianPromoterPhCMV / PPGK / RPBSAAvailable SinceJune 28, 2022AvailabilityAcademic Institutions and Nonprofits only -
pCAG-lox-inv[Talpha1-HA-Dre]-lox-mOrange2-NEDD1-gTBD
Plasmid#196894PurposeNeuron-specific expression of the gamma-tubulin-binding domain (gTBD) of NEDD1 fused to mOrange aimed to displace endogenous gamma-TuRC from the centrosome. Used in combination with Talpha1-iCre-pA plasmidsDepositorInsertN-gTBD-mOrange2 (NEDD1 Human)
UseCre/Lox; Dre/roxExpressionMammalianPromoterQuimeric CAGAvailable SinceMay 16, 2023AvailabilityAcademic Institutions and Nonprofits only -
pCAG-lox-inv[Talpha1-iCre-pA]-lox-2xHA-128-425-Akap9
Plasmid#196897PurposeNeuron-specific expression of fragment 128-425 from A-Kinase Anchoring Protein 9 (Akap9) fused to 2xHA-tags.DepositorAvailable SinceMay 17, 2023AvailabilityAcademic Institutions and Nonprofits only -
pSPIKE-E
Plasmid#101173Purposechimeric spike resembling a fragment of eukaryotic 18S rRNA to be used in metagenomicsDepositorInsertchimeric 18S rRNA
UseSynthetic BiologyAvailable SinceOct. 2, 2017AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-neo-cterminal-3HA
Plasmid#102643PurposeTo generate three copies of the HA epitope tag on cDNAs.DepositorTypeEmpty backboneTags3x HA (YPYDVPDYA)ExpressionMammalianAvailable SinceOct. 19, 2017AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-neo-Strep_Flag_Nterm
Plasmid#102644PurposeEpitope tag n-terminus with SBP-Flag moietyDepositorTypeEmpty backboneTagsSBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPG…ExpressionMammalianAvailable SinceOct. 19, 2017AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-neo-Strep_Flag_Cterm
Plasmid#102645PurposeEpitope tag c-terminus with SBP-Flag moietyDepositorTypeEmpty backboneTagsSBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPG…ExpressionMammalianAvailable SinceOct. 19, 2017AvailabilityAcademic Institutions and Nonprofits only -
E-cadherin-GFP
Plasmid#28009DepositorAvailable SinceMarch 17, 2011AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-HCMVgH (TB40/E)
Plasmid#136446PurposeMammalian expression plasmid for HCMV glycoprotein H (TB40/E strain), full-lengthDepositorInsertglycoprotein H (UL75 Human betaherpesvirus 5)
ExpressionMammalianMutationCodon-optimized for human cell expression.PromoterCMVAvailable SinceJuly 9, 2020AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3.1-mNRDc-E>A-V5
Plasmid#51298Purposeexpression of the inactive mutant of mouse NRDc in mammalian cellsDepositorInsertNRDc E247A (Nrd1 Mouse)
TagsHIS and V5ExpressionMammalianMutationE247A, enzymatic inactive mutantPromoterCMVAvailable SinceFeb. 14, 2014AvailabilityAcademic Institutions and Nonprofits only -
pCR3-FLAG-Gephyrin E
Plasmid#68819PurposeFlag tagged mammalian expression of E domainDepositorInsertGephyrin (Gphn Rat)
Tags3xFLAGExpressionMammalianMutationinternal EcoRI site has silent mutationPromoterCMVAvailable SinceSept. 15, 2015AvailabilityAcademic Institutions and Nonprofits only -
pcDNA3-HCMVgL-FLAG (TB40/E)
Plasmid#136449PurposeMammalian expression plasmid for HCMV glycoprotein L (TB40/E strain) with FLAG tagDepositorInsertglycoprotein L (UL115 Human betaherpesvirus 5)
TagsShort SGGSG linker and FLAG tagExpressionMammalianMutationCodon-optimized for human cell expression.PromoterCMVAvailable SinceJuly 9, 2020AvailabilityAcademic Institutions and Nonprofits only -
p172 Dync1i2.E (Ex 1b)
Plasmid#26442DepositorInsertcytoplasmic dynein 1 intermediate chain 2 isoform E (exon 1b) (Dync1i2 Mouse)
UseSubcloning and sequencingMutationN/AAvailable SinceMarch 24, 2011AvailabilityAcademic Institutions and Nonprofits only